Identifiers and Description

Gene Model Identifier

Contig18408.0.0.g92

Standard Name

SPT4b

Aliases

Contig18408_0_0_g92

Description

Spt4/RpoE2 zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR063C0.00000000030007160092483236SPT4 SGDID:S000003295, Chr VII
from 617824-617516, Geno...
T. thermophilaTTHERM_004628490.00000019998969434520019conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18408.0.0.g92(coding)
ATGCCTAAGAAGATCAAGATCATCAAGGATGAAGATGGAAGTGACGTGGGTTCTGAGGAC
CAGAAGCAAGACCTCTACAACGAAGCAGACATCAGTGATGAGGAGGACAGACGCAGACAC
CGCAAGAGAAACAGAAACAAGTACCAATACTCAAGTGGTCCCAAGATCATTGACGATACT
TGGTTGCCCTCGAGCATGAACAAGTTGCGTGCCTGTATCTACTGCAAGTTGGTGCTGAAC
CAGGAGAAGTGGAGCAAGTTGAAGTAATGCCCCAACTGTCCTGAGAGTTCCGCCAGTCTT
GATGAGACCACAGACAACTATGAGAGTCTCATCTCTTTGGTGCTACCACTCAAGAGTTGG
GTGGCTCAATGGCAGTAGATGCGCAACTGCATCCCTGGAATCTACGCAATGGCTGTCAGA
GCTCCTAACTGA


>Contig18408.0.0.g92(protein)
MPKKIKIIKDEDGSDVGSEDQKQDLYNEADISDEEDRRRHRKRNRNKYQYSSGPKIIDDT
WLPSSMNKLRACIYCKLVLNQEKWSKLKQCPNCPESSASLDETTDNYESLISLVLPLKSW
VAQWQQMRNCIPGIYAMAVRAPN