Identifiers and Description

Gene Model Identifier

Contig18001.0.g60

Standard Name

SPT4a

Aliases

Contig18001_0_g60

Description

Spt4/RpoE2 zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR063C0.0000000000599805963605737SPT4 SGDID:S000003295, Chr VII
from 617824-617516, Geno...
T. thermophilaTTHERM_004628490.0000000006000548789370351conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18001.0.g60(coding)
ATGGCAACAAAAGATAAACTTCTAGACTCAGCTGATTATGTTCCTGATGCTGTGAGAGGA
CAACAAGCTTGCACTGGTTGTGGTCTAATTTTGACGTCAAGCTAATGGAAAGAGAACGGT
TCCTGCCCAAACTGTAAGGATGAAGCGCATTTAGAGACTACCAATGATTTTGGTGGTGTA
GTCGCACTGATGCATCCTAAGGAAAGTTGGGTGGCTAAATGGAATAATTTTACTAAGTTT
GTTCCAGGATTATATGCAATTCAATTCCAAGAACATAACCAGTATAATCCAGAAAATGAA
TATGAAATGAACGATGACGAATGA


>Contig18001.0.g60(protein)
MATKDKLLDSADYVPDAVRGQQACTGCGLILTSSQWKENGSCPNCKDEAHLETTNDFGGV
VALMHPKESWVAKWNNFTKFVPGLYAIQFQEHNQYNPENEYEMNDDE