Identifiers and Description

Gene Model Identifier

Contig21845.0.g89

Standard Name

SPT16a

Aliases

Contig21845_0_g89

Description

FACT complex subunit (SPT16/CDC68)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam08644 ) FACT complex subunit (SPT16/CDC68)
  • ( pfam00557 ) Metallopeptidase family M24
  • ( pfam08512 ) Histone chaperone Rttp106-like

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002833303.99907102031635e-130metallopeptidase family M24 co
ntaining protein
SGDYGL207W4.0007753645635287e-88SPT16 SGDID:S000003175, Chr VI
I from 98969-102076, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21845.0.g89(coding)
ATGAGTATTAATATCAACGGCCCAGCCTTCTACAAAAAATTAAAGAAATTTGCGGAATAT
TGGAAAAAATCAGAAAAACCTCAATCTCAAAATAGTGAAGATCTTGCAACAAAATATGAT
TTTTTCCTCTTCGTATTAGGTAAAGTTACAGACTAAGATATTCAGAAAAAGACATAAATA
TTGCATACATGGCTTTTATCTTATCAATTCTCAGAAACAGTGTTTTTATTTTTGAAAGAT
ACTTTTTATGTGCTCACTTCTCAATAAAAAAAGTAATTATTGGAAAGTTTAAAAGTTCCA
GAGGGATATGATGGTCCAAAATTGAAAGTTATTCTAAGAGATACCAAGGGCGACCAACTT
TAAGTATTTAAAAATTTCATTTAACAAGCGATTGGTGATTTATCAAATATAAAAAGAGAA
ATTGGTTCTTTTTCTACTGAAAATCCTGATGGAACCTTTGCTTAAGACTTCAAAAAGAAT
TTCAGCAAGCATTTCCCCAAAATACCTATAAAAGATTGCTCAAAATTTTTTGAAGAAATT
CTTCTTACAAAAGATGAGTACGACTTAGAGTCAGTGAAAATATCCTCATTATTTTCTGGG
TTTATGATGAAACAGCTTATTACTGAATGCGAGGAAATCATTGAATCAAATTCTTAGGAA
AATCATGATAAAATTGCAGCCAAATTGGAATCGATTTTGGATAAGCAGGATGAGATGCAA
AAATTTAAGAAACTTCTCCCTGAAGAATTGAAGAAGGACTATGATCCACAATGTCATGAA
TTTTAATACTCACCTAGTGTGTAAAGTGGTGGAACATATAACATAAGAATGGGAGCTCCA
AATAATAACAAACCTCTTAGTTCAGATACCATTTTGCTATCGATTTGCACCAAGTATAAA
GACATCAGCACAAACATAAGTAGAACGCTTATTATAAATCATGATGATGAACGAAAAGCT
GCCTATGAATTTATGACACTAATCTTCAAGCATGCCACTGAATAGCTTAAAAGTGGAGTA
AAATGTGGTGAAGTTTATCAAGCTGTCATTGATAAAATTAAAGAGCTTGGGAAAGACGAA
TATATCAAGTTTATGCCATCTATTTTAGGTCAAGGAATAGGCATGTTTCCAAAAGAAGAC
CAACTTTAAATTATGAAAGATAATCACAGAGTACTCGAAGATAACATGGTTATTAATCTT
AAATTTACAATAGCAAATTTTTCAACTTAACCCACTAGAAATTGCTTAATTTTGGCAGAT
ACAATTCTAATTAAAGGATAGACTCCATAAGTACTGACCAATAAAGTAAAAAAGGATTAC
CCTGATATTTCTTATACAATTGACGAATTTGATGATGTTGATGAAAATGAAAATACAAAT
GCCACAAACACTAAAGCCAATAATTCTAAAAAATAAAGTGGAAAATAGCAAATTAATACT
TCAACAGTGGTAGACAAACAAAAAGCTAGTAAGGTTGCGGAAAAGATAGCTAGAGGCGAT
AAAATTGGAGTTATTTAAGGGGAAAGATTAAGGAATCATCAAAATCTTAATATAAACGCT
GATGATGACAAAAGAAAGGCTGATTAGATAGAATTATTCAAACTCAAATAAGAAGAGCTT
AAGCAAAGACTCGAAGATGGTGATATTAAGTTTGGTGGGAAGTAAGGCAATCAAGCTAAA
GACTTGGATTCTGTACATGCTTACAAAAACTCTTCAGAATTTCCAAAGGAAGCAAGAAAC
TTTTAATTTTGTATAGATAAAAATAAGCATTGCATATTAGTGCCATTTAAAGACGAAAAT
GGCAATATAATGATGGCTCCTTTTCACATATTAACAATTAAAAATGCCTCAATTAGTACT
GAGAACAATATCAGCTATTTAAGACTAAACTTTCACTGTCCAGGATAAGGCTTATCTTCA
AAAGAGGTTAACTTTCCTTCGATGAAAGGACCATAACAAGCCTATATAAAAGAACTGACT
GTATAATCAAATAATTCATAGTAGCTAAACACATCACTTAAAATTCTAAAAGAAGTATAA
AAAGTAGCCAAATTGAGCGAAATTAATTAGAAAAAATCAAATGACTTAAACGATGAAGAG
TAGCACTTAGCAGATGAGGCATTAATAATTTCTAAGCAAAAAAAGGTAGTCCTAGATAAT
GTACATGTCAAGCCAACACTTGCAGGCAAGAAAACAGTTGGAGCTTTGGAAACTCATATT
AATGGATTTAGATTTATGAGTTCCAAAGGCCAAAAATTAGATATAACATTCCGAAATATC
AAGCATGCTTTTTACTAGCCTTGCAAAAAGGATCTTATAGTACTTTTGCATTTCAGATTA
AGAGTTCCAATCATAGTAGGAAACAAAAAGGTAGTTGACATTCAATTTTACACTGAAATT
TGTGCCTTAGTTGATGATTTAGATTCGAGAGGAGCAGCTCGTAGAAGAATGAATGAACAA
GACGAGCATGAATAAGAAATTAGAGAAAATCAAAATAGACTAAGACTAAACGATAAGTAT
CACAAGTTCTGTCAAAACGTAGAGACTTTTGCTAAAGAAAACAGATACGATATTGAGTTT
GATATTCCTTATAAGAAATTGGAATTTGCAGGATGTCATACTAAGTCAAGTGTTAAAATG
ATACCTACAGAAAAATGCCTGGTTGCACTCTCTGAAGTACCGTTCTTTGTGATGGATTTA
TCCGAAGTTGAAATTGCTCATTTTGAAAGAGTATCCTTTATGACAAGGAATTTCGATCTT
GTGTTCTTACATAAAGACTATCAGACCTTTAAACGAATCAGCACAATACCTAATGAAGAA
GACTTCTCAGGCTTCGTTCTGAATGATGGTGGTTGGAATTTTTTATGTGATTAATAAGGC
TCAGATGAAAATTAGCACAGCGACGATGAAGAAAACAGCGACTCAGAGTATAATGAATCG
GAAGATGAAGAAGTGGGAAGCGACAATTCGGAATCAGAAGATGACAGCGAATTTTCAAAA
GAGGCAAGTGATGCAGAAAGTTCAGATGTAAACCCAGACGAAGAGGAGGAAGAAGAGGGC
ATGGACTGGGATGAATTGGAAAAACAAGCAATGGAAGAGGAGAAAATTAAAAATGATCTT
GCAAAAACCAGACTTAATCAGGAAAATGCAATGAAAAAGGCGCCAAGTGGTAACTATGGT
GGAGGTAAGAAAGCCAACGGAAATTAACTGGCTAAAGCAAGTGGAATGATGAACCCTAAA
AATAGCATGATTGGGAGAATACCTAAGAGAAGATGA


>Contig21845.0.g89(protein)
MSININGPAFYKKLKKFAEYWKKSEKPQSQNSEDLATKYDFFLFVLGKVTDQDIQKKTQI
LHTWLLSYQFSETVFLFLKDTFYVLTSQQKKQLLESLKVPEGYDGPKLKVILRDTKGDQL
QVFKNFIQQAIGDLSNIKREIGSFSTENPDGTFAQDFKKNFSKHFPKIPIKDCSKFFEEI
LLTKDEYDLESVKISSLFSGFMMKQLITECEEIIESNSQENHDKIAAKLESILDKQDEMQ
KFKKLLPEELKKDYDPQCHEFQYSPSVQSGGTYNIRMGAPNNNKPLSSDTILLSICTKYK
DISTNISRTLIINHDDERKAAYEFMTLIFKHATEQLKSGVKCGEVYQAVIDKIKELGKDE
YIKFMPSILGQGIGMFPKEDQLQIMKDNHRVLEDNMVINLKFTIANFSTQPTRNCLILAD
TILIKGQTPQVLTNKVKKDYPDISYTIDEFDDVDENENTNATNTKANNSKKQSGKQQINT
STVVDKQKASKVAEKIARGDKIGVIQGERLRNHQNLNINADDDKRKADQIELFKLKQEEL
KQRLEDGDIKFGGKQGNQAKDLDSVHAYKNSSEFPKEARNFQFCIDKNKHCILVPFKDEN
GNIMMAPFHILTIKNASISTENNISYLRLNFHCPGQGLSSKEVNFPSMKGPQQAYIKELT
VQSNNSQQLNTSLKILKEVQKVAKLSEINQKKSNDLNDEEQHLADEALIISKQKKVVLDN
VHVKPTLAGKKTVGALETHINGFRFMSSKGQKLDITFRNIKHAFYQPCKKDLIVLLHFRL
RVPIIVGNKKVVDIQFYTEICALVDDLDSRGAARRRMNEQDEHEQEIRENQNRLRLNDKY
HKFCQNVETFAKENRYDIEFDIPYKKLEFAGCHTKSSVKMIPTEKCLVALSEVPFFVMDL
SEVEIAHFERVSFMTRNFDLVFLHKDYQTFKRISTIPNEEDFSGFVLNDGGWNFLCDQQG
SDENQHSDDEENSDSEYNESEDEEVGSDNSESEDDSEFSKEASDAESSDVNPDEEEEEEG
MDWDELEKQAMEEEKIKNDLAKTRLNQENAMKKAPSGNYGGGKKANGNQLAKASGMMNPK
NSMIGRIPKRR