Identifiers and Description

Gene Model Identifier

Contig3069.0.g49

Standard Name

SPRY1g

Aliases

Contig3069_0_g49

Description

SPRY domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007664509.996273942859018e-26SPRY domain containing protein
SGDYGL227W0.00010003404299092957VID30 SGDID:S000003196, Chr VI
I from 69671-72547, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3069.0.g49(coding)
ATGTTAGTAGACGACTCTTTAAGCGCTCAGAGCCCGCACGCTGCGGCTCTATAACAAGCA
ATGCAAGAAATTATACCTGATGGCTTTGAATGGGCAATGTTTCAATGGGACACAGAAAAA
TCTAGCAAAAAACTACAAATAGACGAAGATTTACTGACCGTAAAAGTAAAAGACGGTTCA
GGCTTCAAAACTTCCTTTGGAGATTAACCCTTCAAAGCCGGAGGCCGATACTACTTTCAA
GTGCAGTTAAATCAAGGCAACTTAGTGAAGATAGGAGTCTCTCGCAAAGATATACAAGCA
GACTAGGCGTTTTCTGATTCGCAAAGCGGATGGGCTATATATAATGGAGAACTTAGACAT
AATAGTAATTCTAGTGGGCCAAAATATGGCTCTTCAGTATAAGCAGGAGATGTAATTGGA
GTTATGCTCGATATGGTTGAGGGAACGATATGTTTCAGCAAAAATGGTAGAAACTGGGGT
GTCGCTTTTAAAGATGATGAACTGAAGAAAGGGGAATTGTTTCCTGCAGTGGCTCCTATT
TACAGTGGAGACAGCTATAGTATCAGAAGACCAACTCCAGAGGATTGA


>Contig3069.0.g49(protein)
MLVDDSLSAQSPHAAALQQAMQEIIPDGFEWAMFQWDTEKSSKKLQIDEDLLTVKVKDGS
GFKTSFGDQPFKAGGRYYFQVQLNQGNLVKIGVSRKDIQADQAFSDSQSGWAIYNGELRH
NSNSSGPKYGSSVQAGDVIGVMLDMVEGTICFSKNGRNWGVAFKDDELKKGELFPAVAPI
YSGDSYSIRRPTPED