Identifiers and Description

Gene Model Identifier

Contig21151.0.g78

Standard Name

SPRY1f

Aliases

Contig21151_0_g78

Description

SPRY domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007664509.002093297142233e-23SPRY domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21151.0.g78(coding)
ATGCTTCCTGCTTCCTCTCTTCAAGATGTTAGTGAGGGCATCCCATCTTTGCTTTTGACA
TAAATCCAATCTCAATTATCAACTAATACTTCATCCATATATCAATAGAGATCTCCAGAC
TACATAGACAGCTTCAATCATATAGCATTTTAATGGGATACTAGGAATATTTCTGAAAAT
TTGGATATCAGTGATGATGAAAGAATATGCACTTCCAAGACAAGTATGAATTCATTTAAG
TCATGCTATGGAAGTACTTTGATGTTACCAGGGTTTAGATACTACTATGAAGTCAAGTTT
ATTAAAGGAAGCAATTTTAAGATTGGAGTGAGTCGTAGTAAACGAAATTTGGAAATTGCA
TTTTCAGATGTTGAAGATGGCTGGGCTTACTATTCGAATGGACAACTTAGGCATAATAGT
AAGGGAGAGGGTTTAAATTACGGATCTATATTTAGAGGAAAAGATGTTATCGGGGTATTT
GTAGATTTAGTTGAGGGTAAATTGTTCTTTTCTAAGAATGGTAAAATTTTCAAGGATGCT
TATAGGGATGAAGAATTAACAAAACAACCACTCTATCCTGCTTGCAGTTGCCTTACAAAA
GGAGAGTCTTTTGAATTGCTTTTTCCAGCTTGTGAAGATTGA


>Contig21151.0.g78(protein)
MLPASSLQDVSEGIPSLLLTQIQSQLSTNTSSIYQQRSPDYIDSFNHIAFQWDTRNISEN
LDISDDERICTSKTSMNSFKSCYGSTLMLPGFRYYYEVKFIKGSNFKIGVSRSKRNLEIA
FSDVEDGWAYYSNGQLRHNSKGEGLNYGSIFRGKDVIGVFVDLVEGKLFFSKNGKIFKDA
YRDEELTKQPLYPACSCLTKGESFELLFPACED