Identifiers and Description

Gene Model Identifier

Contig18788.0.g30

Standard Name

SPRY1e

Aliases

Contig18788_0_g30

Description

SPRY domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007664500.0000000000000030004923591262316SPRY domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18788.0.g30(coding)
ATGGATTTCGAGAAAATCAACTACCCCTCAGAGACCTATGTTACTTAATTCGACAGACTT
TTCTTCAGCTGGGATGCTCAGTTCATGTCCCCGTGGTTAAAAATGGACACTTCAGGGGCG
TTCTTGGAGGATGGCACACCTGCCAGTTTGGCAATAACATGCAAGCAGACTTTGAGTGGT
GCTCCCACACTCAATTGTGGTAATCAGTTCAAATCGGTTCTCGGTAATTAACCATTCCCA
CAAGGCTACCGCTCTTACTTCGAAGTGAAGATAAACAAAGGAAGTAACTTCAAGATTGGC
ATTGCAGGACGCAAATGTGAGATAAACTTGGCTTTTAGCGATGGCAAAGAGGGTTGGGCT
TATTACTCAGGTGGCTTCCTGAGGCACAATAGCGGTGGAGATGGTCCAAAATATGGTGTA
GCATATAGCGATAATTCCATTGTGGGAGTGTACGTTGACCTAATCGAAGGCAAGCTTTTC
TTCTCTAAAGACGGCCGCATGATGCCCATTGCTTATGAGAATAAGCATTTCTTAACTATG
GAATTATACCCTGCTGTATCTTGCTTCTAGCCTGGAGAAAGTTTTCAGTTGATTATGCCA
ATGCCAGAAGACTGA


>Contig18788.0.g30(protein)
MDFEKINYPSETYVTQFDRLFFSWDAQFMSPWLKMDTSGAFLEDGTPASLAITCKQTLSG
APTLNCGNQFKSVLGNQPFPQGYRSYFEVKINKGSNFKIGIAGRKCEINLAFSDGKEGWA
YYSGGFLRHNSGGDGPKYGVAYSDNSIVGVYVDLIEGKLFFSKDGRMMPIAYENKHFLTM
ELYPAVSCFQPGESFQLIMPMPED