Identifiers and Description

Gene Model Identifier

Contig3861.0.g25

Standard Name

SPRY1d

Aliases

Contig3861_0_g25

Description

SPRY domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00622 ) SPRY domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13639 ) Ring finger domain
  • ( pfam03644 ) Glycosyl hydrolase family 85
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)
  • ( pfam05025 ) RbsD / FucU transport protein family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007664507.003377498796081e-81SPRY domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3861.0.g25(coding)
ATGAGCGCATCCAAGGCGACTACTTTTAATCCTGGGGGTTTTGACATGGAAAGAATCGAA
GATGGTGTTATGCATTAAGAATTAAAAGACTCCCTATTATGTGGTATTTGCTTAGAGTTG
CTGAGAGATCCCATGGAGTGCGATAATTGTAGAAAATTATTTTGCAAAGTTTGTATTTAA
AGATGGGGTAAAAACTGTCCGTTTTAATGCCCAGGTATTTTGAGAGTTCGTCCATCATCT
CATGTTATCCATGAGTTCCTCAAAATAATTCGAGTCAATTGCCATTAATGTGAAGAGTTA
GTTAATTTCACTACAATTGAAGAGCACGAAGAATGGTGCAAAAAATTGAAATGTGCGAAT
AAACAATGTCAAACTATTCTCGAATATAGAAGCAGAAAAGAATTCAAAGTGAAGGACAAG
TCTATACAGGTTTGTGACAATGTTTGCTACGAAATGTATCTCCTTCAATAAGCTTTTAAG
AAGCAAGACCCAGAACACATCCTGAAATATATTGATGAATACTTAACAGAGGAAGAGGAA
AAAGAAAGTGCCTTGGAACTAAAAAAGAGAGAGGAAGAAAGTTAAAGAACCAAAAGTAGA
GATCAAATTGATTTGATGCGTAAAATGGATGATCTTAACATACAGAGGGACATTGTAGGA
GTTGTAATATCTCAATTCACTTGGGATAGGACAACACTACCAAAAGAGGTCAAAATGAGT
GACGATTTGAGAACTTTGTCACTTGTTGAAGATGACTATATTTTCAGAACAGTTTATGCA
GATATTGAGCTGACTGAAGGAATTTACTATTGGGAGCTAATTGGTGACTCAAAGTGCGAG
CATGAGCTAAAAGTTGGTGTTTCTGGTTAAAAATAAGTAAACTAAAAAGCTGCTTTCAGT
GATTATGAATATGGCTGGGCATATTTTGGGGTGGGATAACTTAGACATAATTCTAACTCG
ATAGGGCCACGATACGGCAAGCCTTTCAAAAAATACGGAATACTTGGAGTATTCTTAAAC
ATGAATAAAGGCACTTTGGCATTTGCGCTTGATGGTTAGTATTTTGGCGTCGCATTTGAA
GATGAGGGATTAAAGCAAGGTCCTTTGTATCCAGCTGTATCTCTTTTACATTCAGCTGGT
TGTATATTAGCAACTGGAAAAGCCCCTCCACAATATTTCTTCGAGTGA


>Contig3861.0.g25(protein)
MSASKATTFNPGGFDMERIEDGVMHQELKDSLLCGICLELLRDPMECDNCRKLFCKVCIQ
RWGKNCPFQCPGILRVRPSSHVIHEFLKIIRVNCHQCEELVNFTTIEEHEEWCKKLKCAN
KQCQTILEYRSRKEFKVKDKSIQVCDNVCYEMYLLQQAFKKQDPEHILKYIDEYLTEEEE
KESALELKKREEESQRTKSRDQIDLMRKMDDLNIQRDIVGVVISQFTWDRTTLPKEVKMS
DDLRTLSLVEDDYIFRTVYADIELTEGIYYWELIGDSKCEHELKVGVSGQKQVNQKAAFS
DYEYGWAYFGVGQLRHNSNSIGPRYGKPFKKYGILGVFLNMNKGTLAFALDGQYFGVAFE
DEGLKQGPLYPAVSLLHSAGCILATGKAPPQYFFE