Identifiers and Description

Gene Model Identifier

Contig6163.0.g77

Standard Name

SPRY1a

Aliases

Contig6163_0_g77

Description

SPRY domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007664502.0001503375893664e-79SPRY domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6163.0.g77(coding)
ATGAATAACATTAGATTGACAGGGTACGATTCAGACAGTATCGGAATATTCAATATTCCA
AAAGAATTCACCAGGTTCCTTCAGTGCTAAATTTGCTTCAAGGTAGCTAGAGATGCAAAA
GAATGTGATTATTGCAATTAATTATTTTGCAAAAGATGTATTGAGAATTGGCTGATCTTG
AACAAAAACTGTCCAATGTGCCATAGAGATATTAGAATTCGTGGAGCGTCAAGAGTAGTC
AAGGAAATTATTTAGTCCTTCAGAATGAAATGCCAATATTGTCAAAAAGTATATAGACTA
GCCGAGATAGAATAGCATGAGCAGTAATGTGGTTAAATTACTTGTGATAACCCATTATGT
CAAAAGTAACTTGAAAATCAAAAATACTACGAAGTTGTCACTTCAGAAGGAAAACTTTGT
GTATGCAATGAGATATGCGAGAACTTAGCAAAATTCAAGAGAATAAAAAATAAGAAGGGA
GATATTGATTGCCTCAAATTCTACCAGTCTAATTTATCTAGTGCTTAGGCTTTAATGGGA
GATAGCTCTTAAGGGGTATCTTCAAGTGACTAATTAGAAATTGCTAATGACATGCGAGTT
TTAAAAAGAATTGAATGCCTTTCTCCAGATTTCATTTAAAAGATGCAAATGAAATCTTTG
ACACATTTTAGATGGGATCCACTATTGACCTCAGACTCAATTGAATTGACTGCAGACAAT
AGAACTGCATATTTACAGGAGGACACCTATTTATTCAGAAGCATTATTGCAGACACTAAA
TTTGATGGAGGTCTTCATTATTGGGAGCTCGTTGCAGATTCTAGAACAGATAATGAGTTA
AAAATTGGAGTATCAAAATCAAGAGATATAGACTTAAAAACATCTTTCAGTGATTATTCA
ACTGGGTGGGCTTTCTATGGAATAGGCTAGCTTAGACATTGCGATTCTGCAAACGGTCCT
AACTATGGAAAGAGCTTCAAGAGAACTGGAACACTTGGAATACTACTAGATATGAATAAA
GGTGCACTTTCATTCTCCCTTGATGGTGAATACCTTGGGGTAGCATTTGAAGATGAAGAG
CTAAAGAAAGGGCCTATTTATCCAGCTATAGCCTTATTGCATATTGCAGGATGCACATTA
GTTACAGGGAAGCCAGCACCAGCTATTTTCTTTACATGA


>Contig6163.0.g77(protein)
MNNIRLTGYDSDSIGIFNIPKEFTRFLQCQICFKVARDAKECDYCNQLFCKRCIENWLIL
NKNCPMCHRDIRIRGASRVVKEIIQSFRMKCQYCQKVYRLAEIEQHEQQCGQITCDNPLC
QKQLENQKYYEVVTSEGKLCVCNEICENLAKFKRIKNKKGDIDCLKFYQSNLSSAQALMG
DSSQGVSSSDQLEIANDMRVLKRIECLSPDFIQKMQMKSLTHFRWDPLLTSDSIELTADN
RTAYLQEDTYLFRSIIADTKFDGGLHYWELVADSRTDNELKIGVSKSRDIDLKTSFSDYS
TGWAFYGIGQLRHCDSANGPNYGKSFKRTGTLGILLDMNKGALSFSLDGEYLGVAFEDEE
LKKGPIYPAIALLHIAGCTLVTGKPAPAIFFT