Identifiers and Description

Gene Model Identifier

Contig240.1.g138

Standard Name

SPRTN1

Aliases

Contig240_1_g138

Description

SprT-like family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008400208.998258374026963e-65hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig240.1.g138(coding)
ATGAATAACAATAATCCAAGAAACAATATACCAACAAATCCCTAAAGATAGCAGATAAAT
TTTGATGATGATATACCTATTTAAATTGATACAACTATCCCTAAAAATTCCTTACAATCC
CAAAACCTCTTGACCTCTCTTCGTCCTCTCTCTCATAAGACTGATGAGGTTACTAAATCC
AAGAAGTCTCTGGATAAAGAAGAGATCAAAGCTCAGATTGAGACAATCACTTAGTACAAT
AAAATGCTATCGAAGATGGAAATTAATGAAAAAGTTTTAAATTGTGATATTCATGAATTG
TTCCTTTTCTATAACGTTGCTTTCTTCCAAGGCAAACTCGATTGTGTGATTTTGGAGTGG
AGCACAAAGATGACTTTGTGTGCAGGCATCTGTTATTATTAAAATGGTCTTTGTACACTA
AGATTAAGCAAGTAATTGCTTAAGTATAGATCAGAGAAGGAGTTATAAGAAACTCTGATT
CATGAAATGATTCATGCTTACTTGTTCTTAACTAAGAAAAGCTACTCTAGAGATGGATCT
GATGGCCATGGACCTGACTTCTAAGGGAAAATGCGTGAGATCAATGAATAAACTGGTTTT
AACATCACTATTTATCACTCTTTCAACGATGAAGTTGAGAGTTATAGATAGCATGTCTGG
CTTTGCAATGGTAAATGCAGAAAATAGCCTCCTCACTATGGAATGGTAAAGAGATAAATG
AATAAACCTCCTGGCACTTATGATGATTGGTGGGAGAAACACTAGAAATCCTGTGGTGGT
CAGTTTATCAAAATAGCTGAACCTGAAGGTTACAACCCTCCAAAGCCTAAGAAAGATCAA
GTTGAAGCTTCAAACAAGCAGTTGTGTGATTTGAACACCCTAGACAAATTCTTTTAGCGC
ACTTCCAACCAGAAAGAGCCCCAGGATAACTCAAACAAAAAGCCTAATAATATGATATAG
AGTAGTGTGAAGAGCAGTGAAGAGGAGAAGAAGAAAGATGACGAAGTAAAGTATGAATTG
CAACCTCAAAATATGCCTTTAAAGTACATCACTGGCTAGCTGGATAAAAAGCGCAAAAGA
TCTGAAATTCAAAGTGAAGTCCAACCTGCACTCAATAATAACAATGTCATGAATAACAAT
AATAATAATAACTCAAGCAATAGAGTAAATCCTGCAAATAACATGTTGAATTAAGTCTAG
TAATAAAATGATAGTGATTAGCAATTGGAGTAGTAAAATATACGAAGAATAAGAGCAAAT
CCTGCATAGGAAGAACTGCAACAAAATCAAGATAGCGATGATTCATTCGAGGAAGATTTA
GCTATGTAGATTGCTTTACTCAATCAGTTAGGTTTGATGTGA


>Contig240.1.g138(protein)
MNNNNPRNNIPTNPQRQQINFDDDIPIQIDTTIPKNSLQSQNLLTSLRPLSHKTDEVTKS
KKSLDKEEIKAQIETITQYNKMLSKMEINEKVLNCDIHELFLFYNVAFFQGKLDCVILEW
STKMTLCAGICYYQNGLCTLRLSKQLLKYRSEKELQETLIHEMIHAYLFLTKKSYSRDGS
DGHGPDFQGKMREINEQTGFNITIYHSFNDEVESYRQHVWLCNGKCRKQPPHYGMVKRQM
NKPPGTYDDWWEKHQKSCGGQFIKIAEPEGYNPPKPKKDQVEASNKQLCDLNTLDKFFQR
TSNQKEPQDNSNKKPNNMIQSSVKSSEEEKKKDDEVKYELQPQNMPLKYITGQLDKKRKR
SEIQSEVQPALNNNNVMNNNNNNNSSNRVNPANNMLNQVQQQNDSDQQLEQQNIRRIRAN
PAQEELQQNQDSDDSFEEDLAMQIALLNQLGLM