Identifiers and Description

Gene Model Identifier

Contig17826.0.g109

Standard Name

SPP2

Aliases

Contig17826_0_g109

Description

DExH-box splicing factor binding site

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004867401.000361553249356e-16KOW motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17826.0.g109(coding)
ATGAGCAGTGAAGTAGCAATTCAACGTTAAGATCAATCTTACGGTGATTCAAACAATAAT
AATCACAATTAGTCTACAATTGATACGAATATGAGTCCTCACACCTAATAAGCAGAAAGT
TAGTAGGAGACTTTTAGTTCGTTGTTTCCAGCACATCTTTATTTGAATAGAAATAGAGAT
CATTAGGGAAGCAATAGGCATGATTAAATCTCAACAAGCACAAACTCTTTTGCTAACGAC
ATAGCAAACTCAAAAGCCTAAATAGGAAAAGACATGGACGAAGAAGCCTATGATAGAATG
CCGATTGAAAGCTTTGGGAAGTCTGTATTGTCTAAGTTCGGTTGGCAAGAAGGAGTTGCT
GTTGGTAGAAATGCTGCTACTTCGAAAATTGTATAGCCTATTGATTACATGCCTCGTTAG
CATAGACTTGGTTTAGGAGCTAGACCCCTGTCGAAAGATGAGCTCAAGAAAATGGGTGAA
GATGGCGGAGACTGGGACCGCAGAAAGTTGGCAGTTACAGAAGACTACACTTAACTAGAA
GGAGCAGAGGGGAAAAACTTCAAGAGTATTCACACATAACTGAAGCGTCGAGAAAAGATG
CAGATCAATAGTTTAATTTGCATAACTGGGGGAACTCACAAGGGTCTCGAAGGGAAAATT
GTTGCATTGTCTGATCCCAAAAAAGGCCTTAGGCAACAGCAATAACATATGGGAGAGCAA
GTAAATGTGGATGAGATCGATGCTGAGGCATATGTGAGTGTTGAGCTTTCCCTCAATGAA
ACAATAGTAAACATAAAAAGAAAAAGAATTATACTAAAGTCTGATTAAGTAAAAATGGAT
AATCTTGTTGGCGGTGATAATCAAAAGAAGGATAAAGATCGTAAAAGAAGCAGAAGTAGA
TCATTACAAAACAATGATAAAGATGGCTCTAGAAATCGAAATGAAAAGGATAAGCATAGA
GATCGTGATGAAAAATAGTATAAGAAGCTTAAATGGCTCTTACCAGGTTTGATTGTCCGA
GTAGTCTCAAAGAAAGTTGCTAATGGAAAATTGTATAATACAAAAGTTCGTATTACTGAT
GTCTTAAATGATTCCAGATTTCTTGCTGCCCCATATGGCCCAAGTTCAAGTTCTAATGGA
GACTTTAATAATCAAGTTTATGATAATCTCAGAGAAAAAGATTTGGAAACAGTTATACCA
AGGGATGAAAATCAACCTGTGGCAGTACTTAGAGGAGAATTTAAGGGAGAGACTGGGAAA
ATACTATCGAGAGATAAGAAGAGGGATTAAGTAGTAATTTAAGTTGGCCTTACAGATATT
GTTACTGTATCTTAAGATGATTGTTGCCAAATATCACAAGACGATAATTATTGA


>Contig17826.0.g109(protein)
MSSEVAIQRQDQSYGDSNNNNHNQSTIDTNMSPHTQQAESQQETFSSLFPAHLYLNRNRD
HQGSNRHDQISTSTNSFANDIANSKAQIGKDMDEEAYDRMPIESFGKSVLSKFGWQEGVA
VGRNAATSKIVQPIDYMPRQHRLGLGARPLSKDELKKMGEDGGDWDRRKLAVTEDYTQLE
GAEGKNFKSIHTQLKRREKMQINSLICITGGTHKGLEGKIVALSDPKKGLRQQQQHMGEQ
VNVDEIDAEAYVSVELSLNETIVNIKRKRIILKSDQVKMDNLVGGDNQKKDKDRKRSRSR
SLQNNDKDGSRNRNEKDKHRDRDEKQYKKLKWLLPGLIVRVVSKKVANGKLYNTKVRITD
VLNDSRFLAAPYGPSSSSNGDFNNQVYDNLREKDLETVIPRDENQPVAVLRGEFKGETGK
ILSRDKKRDQVVIQVGLTDIVTVSQDDCCQISQDDNY