Identifiers and Description

Gene Model Identifier

Contig737.1.g131

Standard Name

SPP1a

Aliases

Contig737_1_g131

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL138C0.0000000010002658722841845SPP1 SGDID:S000006059, Chr XVI
from 292427-291366, Geno...
T. thermophilaTTHERM_005021200.000000019990673443141236PHD-finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig737.1.g131(coding)
ATGAGTGAAGCTGAATTCAACCTAAACATTCCTCCCATCGACATCAAGAGTGAAGAGTCC
CATGAGGGGCAAGATGTGCAATCCTAAATTCAGGGTCAGGCAAGTCCACATGATTCCTCA
TTAGACAACTAATCTTAAAACTAAAATGCCAACTAGCAACCAAATTCAAGAGTGTCTCAG
AGAAACCTTATCAAGGCAAAAGAGAGTGCCCCAGCTGGCAATGAATCTAGAACTTTCACA
TCAGTGGCCTAATCATCCAGAGGAGCTGGCATTGGAGGCTCGAAAGGAATGAAACTTGAG
CTGACTGAAGCAGAAAAAGAGTTGCTTCGTTTTGGAGACTTCTCATCTAAAACTACCTCT
GCAGTTGCTGTAGCCTCATAAGCAAACGCAAAACCAGGTAACAGACATTTGAATTGTTTT
AATGCTTATTTCAGGGGTAATGAGAGCATTTTGGATGGATCACAGCGTTAAAGTCGCTTT
AAGACTAATTATCATGATGACTTTGTCTACGGAGATCTTGCATTGAGAAAGTAAATCAAC
TAAAAAGATTAAAACAAAGATAATTCAAATTCTGCATCAGGTGGAGTTGCTTAAAGTGGA
AACTCAGAATCAGGCAAGACTACTCAAAAAGGGGAAGTTGCTAACGCTGCCACAACTAAA
TCGAAGAAATCACAAGCTGCAAAAAAGGCAAAATAAGCTAAAGACTTAAGTAACTAACCA
CAAGTTATTCTTTCGTCAAATCCATCGCTTCAGTTGCCAATATATTACAATTAAGCATCA
CAATTAACTCAACAAGCACCTGGAGAGCATGTTAAGCTATACTGTGTTTGTAGAACTGCA
GATGAAACAGCTGACATGATTGGTTGCGATAAATGTGACGAGTGGTTCCATTTCGTTTGT
GTTGGCATTGACCCAACATCAGTGCCTGATATGGATAGCTACGAATTTGTGTGTCCTGAA
TGTGTCAAGAAATCTACAAAACCTCAAGGAAAGAGATCTCAAGTTAGTTAAAATTAGACT
TAAGTTTAGTCATAATCAACAACTGCCAATAAAAGAAACTAGAAAGCACAGGCAAAACAG
CAGCCCAAGTAAACTTTAAATCAAGAGACTGTGAGTGAAAATCAAATCAAGATAGCAACA
GCCAGGAACACAATTCAACTACAAAACTAGCAGTCAACTAATTCTAGTTAAGCATAAAAC
CAGGGGAAGAGAAAGGGATAAAAAATAGAGAAGTCTCAAGCATCACAACATGATGATGGG
CTTACATCTTAGAAATCATAAACAATGAGCACTATTTCAATCTTAAATCAACTCCCTTAG
TAATCTAAAATGCATCAGGCTAATTTAAATGCAAATCAGTAAAGTACTCTAGGGTAACAA
CAAGTTAAAAGAGTAAGTGGATCTGGAAGCAAGAAAACTCTGTAATAAGCCAAAAACTTA
AACCACCCAAATGGAGGAGCATCTCACTAAGAAGGAAGAGGCAAGATTATCGTAAGCACT
AACTTATCTGATGCCATGAAATAGCAATCAAAGAGACATCAAAAGAATCATCGCTTTAGT
GAATAACAAGATGACTTTATTGATAATGAAAGCCAGATGCATGAAAGAGAAGAAGATGAT
CTCATCTAAGAAGAAGGCTCAGATGATTAAATCCAGGAGCAATCTCATTAGCAACAACCA
ATTTACAAATAAAGCAGGGGAATTAGATAGCAAAACATTCATCAAAACTAAAATAGAGGA
AATGCAATTACTGGTGACTTCACAAGAGCTAAGAGACAGTAATTCTATGAAGATTAGAGA
TACGATGAGGACTCTTAGGAGTAATCATAAAGCACCCTCCATAATAATGATAGAAATGGT
AACAACAACCAAAGCATGAGGGGTTAATAGAGAACAATCCATGGTGGAGGCAATACTAGA
ATTGAAAACCCTCTATTGGAGTAGTAAAAGAGAATAAACGAGAACAATCTTGAAAAAGTT
GTACAGCAAGACGACTATTTGTACTTTGTTACAAAAGATGCTAGGGATCAACCTATTGAA
AGTCATTTTAAAATGCCAGTGCCTGATAGAAGGTTGCAAATTAAAGATGACTCTATAGCA
AATCTTAGGAATATACTTCTAAGGTCACAAAGAAACGAGAACAACGCTGAAGAAAAGAAA
GACTAATCTCTCGATGGACTTGCAGCCTCCACAAATGATTTAATCCTACAAAAAGATACA
GTAAATTCCCTAATCGAGATTTTAAAGCGAAAATTCTAGCACAATCTAATAAACATCCCT
TTGGCCTATAGTCACCCAGTTTTAGCACCACCACCTCAACACAATAATAATATGATAATG
GGTAATTTAAATTTGATGTCAGGCAATGGGAATAATAATAATGAGATTATGCGACATTAA
TAATAGTAAGTTCCACTCCCTGAAGCCCTGTTTCACCAAGAATGA


>Contig737.1.g131(protein)
MSEAEFNLNIPPIDIKSEESHEGQDVQSQIQGQASPHDSSLDNQSQNQNANQQPNSRVSQ
RNLIKAKESAPAGNESRTFTSVAQSSRGAGIGGSKGMKLELTEAEKELLRFGDFSSKTTS
AVAVASQANAKPGNRHLNCFNAYFRGNESILDGSQRQSRFKTNYHDDFVYGDLALRKQIN
QKDQNKDNSNSASGGVAQSGNSESGKTTQKGEVANAATTKSKKSQAAKKAKQAKDLSNQP
QVILSSNPSLQLPIYYNQASQLTQQAPGEHVKLYCVCRTADETADMIGCDKCDEWFHFVC
VGIDPTSVPDMDSYEFVCPECVKKSTKPQGKRSQVSQNQTQVQSQSTTANKRNQKAQAKQ
QPKQTLNQETVSENQIKIATARNTIQLQNQQSTNSSQAQNQGKRKGQKIEKSQASQHDDG
LTSQKSQTMSTISILNQLPQQSKMHQANLNANQQSTLGQQQVKRVSGSGSKKTLQQAKNL
NHPNGGASHQEGRGKIIVSTNLSDAMKQQSKRHQKNHRFSEQQDDFIDNESQMHEREEDD
LIQEEGSDDQIQEQSHQQQPIYKQSRGIRQQNIHQNQNRGNAITGDFTRAKRQQFYEDQR
YDEDSQEQSQSTLHNNDRNGNNNQSMRGQQRTIHGGGNTRIENPLLEQQKRINENNLEKV
VQQDDYLYFVTKDARDQPIESHFKMPVPDRRLQIKDDSIANLRNILLRSQRNENNAEEKK
DQSLDGLAASTNDLILQKDTVNSLIEILKRKFQHNLINIPLAYSHPVLAPPPQHNNNMIM
GNLNLMSGNGNNNNEIMRHQQQQVPLPEALFHQE