Identifiers and Description

Gene Model Identifier

Contig5159.0.g3

Standard Name

SPO11

Aliases

Contig5159_0_g3

Description

Uncharacterized protein conserved in bacteria C-term(DUF2220)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam09983 ) Uncharacterized protein conserved in bacteria C-term(DUF2220)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006270905.0013199114200274e-20Type IIB DNA topoisomerase fam
ily protein
SGDYHL022C0.00000039992052383199455SPO11 SGDID:S000001014, Chr VI
II from 64157-62961, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5159.0.g3(coding)
ATGAAAAACTTAAACTAAAGCTCTATCGATTTTGACTTTTAACAAATGCGGACGATTCAC
TAATTAAAAGTGAATAAGAGAGCTGTTTACTATTCTCTCATTGATAGTAATATAGGCTCG
ACCATGGAATTGGATGGTTACATTTCAGAAATTTGCTTGATACTCTCGTTGCATAGAGAT
GACCTCTTGATTAAAGCCTCTTCGAAAGGATTGATGTTTGGAGGAGGCATAGATTCAGAC
CTTTCTGAGGAGCTTTTGATAAACTAGCTTTAAATTCCAAGTTTAACTGATGAGTAGTTT
TATGAAAAGATTTTACCAAAATTAAAAGCCAAAGTAGTGCTGCTAGTTGAGAAAGATACA
GTTTTCAGCAGGTTAACTTAGCAGTAGTACTTTATTCAAAATAGAGAACACATACTTTTA
TTAACTGGAAAAGGATATCCTGATTATGCAACCAAAAGGTTTGTTAAAATGCTAAGTTAA
ATTGCACATTTACCAATCTTATACCTGGGTGATGCTGATTCATTTGGGGCTGATATATAT
TTTCAATATGCTTTTGGAAACTAAAATTCATCAGTTGACTAAGATGATATTAACTGTCCA
CTTATTCAATGGATTGGTCCATTTATGTAAGATTTTAAGGACATTAAAAAGCAAGATTTG
AGCGAGAAGGATAAATTAAAGATTTATTCCCTCCTAACTAAACCCTACTTTAAGAATTAC
TCAGAATAAGAATGTCACTCTGAAATACATAAGAGTATCTTGAAAAACTTACAGCTTTAC
AAAGGTCATCTGATTCTAATGGAAAGGGAAAATAAAAAATTCGAAATAGAAGCTTTAACT
GTAGTTTAAAACGAATTAAATTTGCACGAAGATCATCATATGGATGAAAATGATGCTCTT
ACATAGCTTCTAACTTATTATATTGATATATTTCTTAACTATTGA


>Contig5159.0.g3(protein)
MKNLNQSSIDFDFQQMRTIHQLKVNKRAVYYSLIDSNIGSTMELDGYISEICLILSLHRD
DLLIKASSKGLMFGGGIDSDLSEELLINQLQIPSLTDEQFYEKILPKLKAKVVLLVEKDT
VFSRLTQQQYFIQNREHILLLTGKGYPDYATKRFVKMLSQIAHLPILYLGDADSFGADIY
FQYAFGNQNSSVDQDDINCPLIQWIGPFMQDFKDIKKQDLSEKDKLKIYSLLTKPYFKNY
SEQECHSEIHKSILKNLQLYKGHLILMERENKKFEIEALTVVQNELNLHEDHHMDENDAL
TQLLTYYIDIFLNY