Identifiers and Description

Gene Model Identifier

Contig1126.0.g87

Standard Name

SPF45

Aliases

Contig1126_0_g87

Description

G-patch domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000464109.000561397357242e-21G-patch domain containing prot
ein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1126.0.g87(coding)
ATGGCATCGATAAAAAAGAAATAATAAAAGCAGGAAGATCTTTTTGGAAAATAAGGTGAT
CCAAATAATAAATTATCAGATTTAGAAAGAGAAGCATCAGAAACTATAAATAAATTAGAT
ACTAGAGCAGGATTGGTTGATATTTATCTTGGAAATCAGGCAGATGAAGAGTATAATCCA
GCATAGCCGAATGATTTTGAGAAAATAATTGGGAAGGCAAAAGCCTTAAAGAAAGAATTA
ATTGCCAGAGTAGAAAGAGAGAAAGCTTTAAAAAAGCAGATTGAGTTTTAAGAATAGCAA
TTACTAGGTTAAAATCAAGAAGAGGAAGATGACTTCAGTCAAATGACTGCAGATGAAGTG
TACTAAGCAAGATTAAAAAAGCGACAGTAATAATCATAGTAACCAGATTAATATGATATG
GGAAGTAGCGAAGGAATGGGGTCTAGCAATAAGGGAGATAATAAAGTCAAGAAAATGATG
GAGGCTATGGGATGGAAAGGTAAAGGCTTAGGTAAGCAAGAGCAAGGTATTATTAATCCA
CTTATTGCAAAGAAAACAGATGCAAATTCAGCTGTAATCGTTGAAAGTTCTATAACACAT
GATTTGCTTGTTGAGAAGCAAGCCTAGAAATAAAAGGAAGATATGTAAATGAGCTTAAGA
GGATTACCTCAGTTACCCTAAAAATAGAGTAAAGTCTTAGTTTTTGAGAATCTAGTAAAT
ATTCAAGAGGTGGATGATGAACTACGTGATGAAGTTAAATTTGAGTGTGAAAAGTATGGA
CCACTTAGCATGTGTATAGTTCATACAGTACCTAGTGAAGAACTTGTAAGAATATTTGCA
TAATACACAAAACTAGAGGATTCTCAAAATGCCTATATAGACTTTAGTTAAAGAGAATTT
GCTGGAAAAATGATTAAAGTTGATTTTTACGGTGAAGAGCTTCTTAAAAATAGATAGTTT
AATATGCCTAGTTTGAATTCATGA


>Contig1126.0.g87(protein)
MASIKKKQQKQEDLFGKQGDPNNKLSDLEREASETINKLDTRAGLVDIYLGNQADEEYNP
AQPNDFEKIIGKAKALKKELIARVEREKALKKQIEFQEQQLLGQNQEEEDDFSQMTADEV
YQARLKKRQQQSQQPDQYDMGSSEGMGSSNKGDNKVKKMMEAMGWKGKGLGKQEQGIINP
LIAKKTDANSAVIVESSITHDLLVEKQAQKQKEDMQMSLRGLPQLPQKQSKVLVFENLVN
IQEVDDELRDEVKFECEKYGPLSMCIVHTVPSEELVRIFAQYTKLEDSQNAYIDFSQREF
AGKMIKVDFYGEELLKNRQFNMPSLNS