Identifiers and Description

Gene Model Identifier

Contig20830.0.g17

Standard Name

SPB1

Aliases

Contig20830_0_g17

Description

FtsJ-like methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009543002.999467474389571e-105FtsJ-like methyltransferase fa
mily protein
SGDYCL054W7.997223287744949e-101SPB1 SGDID:S000000559, Chr III
from 31449-33974, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20830.0.g17(coding)
ATGGGAAACAAGAAACAAAAAAATAAGGCACGTCTAGATAAGTTCTATTATATGGCTAAA
GAGCATGGTTTCAGATCCAGAGCCGCCTTCAAGCTTATCCAACTTAATAAGAAATATGAC
TTCCTCAGCACCTCAAAATGTTTAGTCGATCTCTGCGCAGCCCCAGGTGGTTGGTTGCAA
GTAGCTGCCAAGTACATGCCTGTTGCTAGTATCAAGATAGGAGTCGATCTTACACCAATT
AAAGCAATTAAGGGTTGTGTGACTTTCACTGAGGATATTACTTCAGCAAGATGTTTATAA
TTGATCAAGAAAGAACTTAAGCATTTTAAGGCTGATGTTGTGCTCAATGATGGTGCTCCA
AACGTCGGAGCTGATTGGGCCAAGGATGCTTATAACCAAGCTGAATTGTGTCTTTTCGCC
CTTAAACTGGCAACTGAAGTCTTGAGAAGAGGAGGTACCTTTATTACAAAAGTTTTCAGA
TCCAAGGATTACAACTCATTGCTCTATGTCTTCAACTAACTTTTCAACAAAGTCGAAGCT
ACTAAACCATAAGCCTCAAGAACTCAATCTGCTGAAATCTTCGTCGTATGTCAAGGTTTC
AAAGCTCCAGATGTTATTGATCCAAAGTTCCTAGACCCTAAATATGCTCTTGAAGAAGTT
GAAGATGAAGAAGATGCAGCAAATCAAATCTCTTCTCTTAAGAAGCTTCTCGAGAAGAAA
AACAACAGAGGAGGTTATGAAGAAAATTTAGGTTCTCTTTATCAAGAGACTAACTTCATA
GAGTTCCTTGAAAGTACAGATCCATATGTCTTTTTATCCACTTACAATAAATTCAAAATT
GATGATAAATCCAAGGAGATATTCTTAAAGCAGGCTCCACCCCAAGATCTAGAAATAATT
TGTGAGGACTTGAAAGTGTGTGGCCGTAGAGAGCTTTTCTCAATTTTGAAGTACAGAAAT
AAGTATCAGACTGCGATTGAAGCAGCGAAGAAGAAGGAGAGACAGGCTAAGAATGATTAA
CATGCCAGAGATAACAAGAGAGAACCCACTGAAGCTGAACTTGAAGAGCAGACCAACAAA
GAATTGGAGGAGACTATTAAGAGAGTTGAGAAAGAGCGCAGGAAGCAAGAAAAGAAAGAG
AAGGAGAAGAAAGCAAAGTCCGATCTCCGCCAGAAGATGTCCGTGATTGCCAGCACTGAC
ATATACAACCAGAACGATGAGGTGCTCTTCGATCGCAAAATGCTCGAGAAGTTGCAGGCA
ATGGACATTGAAGAGATGAATTACGAGGGCAGTGACATGGACGAGAATGAAGAACTCGCT
GGAGGAGATATCGTAGTCAGCAAGAAAGCCAGAGCCAGAGAAGCTTAAAAGAAGCAGGAG
GAATCCAGTGACAGTGAACTTGATGGGCTAGGAAGTGATGTGGATGAGGGATTCAAGAGA
ACTCTCAAGATGGAGAAGGATGTTGATGCATTCTATAAATCAAAGAATGACAATTCTATT
GTCAGAGACCGTAAACAAGAAAAGACTGATAGGAAATCCAAGCATTTGATTGAATAACAG
AGGCTCAAGAGACAAGACATGAGGGAAGAAGAGCAGCTGAATAACGAGGATCTTATCAGT
GCTGCTGTTGATGGCACAGGCAGAAAGGTTAAGTTTGCCAAGGATATTGTTGACAGTGAT
GATGACATGAGTGAAAATGAAGTCGCTGCAGAGAGTGACGATGAGGAAGATGACACTGCT
TTCTTCTTAAATCCACTGTTAATGAGCAAGAGTGATGGTGTAGACGGTGGTAAAAATGGA
AAGAAGGGTAAAGAGAGTGATGAAGAATGGTCAGATGATGATTATGATAATGACACAAAA
GATAAGAAAAAGAAGGAGAAAAAGGGTAAGAAGGATTTGAAGTTAGGCAAGAGAAAGAAC
AGAGAGGAAGATAATGATTTCTTTAATAACAAAGATATCGAGGTTGTTCCTTAAGAAAAG
TTTGATGTGGAGTCTGATCTTGACAGTGATGATATGGCAGAGACCCGTGCTCTAGCCAAG
GTCATGCTACGTAAAAAGGCCCGTACAGAAATCATAGATGCAACTTACAATCGTTATGCT
ACCTTCGACGATGAGCATGAGCTCCCAGATTGGTTCGTGACTGACGAAAAGAAAAACTTT
AGACCTAACATTCCCATCACTAAAGAGCAAGTTATGGAGGAGAAGAAAGCCTTAAAGATT
TACAACGAGAGACCATCAAAGAAAGTAACTGAAGCCAAGGCCAGAAAGAAGAGAAGACTC
GCCAAGGCAATGGACAAGATCAAGATTAAAGCCCAGGTTATCGCTGAGTAGGACATCCAC
GAAGGCTCTAAGATGAGACAAATCCAGAAACTTTACCGCAAGGAAAAGACCAAGATGAAG
GAAGACAAGAAATACGTAGTCAGCAAGAACTTCAATCATGTAGGCAAGGCTAACGTCCCC
AGAAACATGAAGGTTGTGGACAAGAGAATGAAGAAAGATCTTAAAATGGCTAAAATTAGA
GCTAAATAAGCCAAGAAGAAAGTTACCAAGGGTAATGGCAAAAGAAGAGGTCCATAGAAA
TGA


>Contig20830.0.g17(protein)
MGNKKQKNKARLDKFYYMAKEHGFRSRAAFKLIQLNKKYDFLSTSKCLVDLCAAPGGWLQ
VAAKYMPVASIKIGVDLTPIKAIKGCVTFTEDITSARCLQLIKKELKHFKADVVLNDGAP
NVGADWAKDAYNQAELCLFALKLATEVLRRGGTFITKVFRSKDYNSLLYVFNQLFNKVEA
TKPQASRTQSAEIFVVCQGFKAPDVIDPKFLDPKYALEEVEDEEDAANQISSLKKLLEKK
NNRGGYEENLGSLYQETNFIEFLESTDPYVFLSTYNKFKIDDKSKEIFLKQAPPQDLEII
CEDLKVCGRRELFSILKYRNKYQTAIEAAKKKERQAKNDQHARDNKREPTEAELEEQTNK
ELEETIKRVEKERRKQEKKEKEKKAKSDLRQKMSVIASTDIYNQNDEVLFDRKMLEKLQA
MDIEEMNYEGSDMDENEELAGGDIVVSKKARAREAQKKQEESSDSELDGLGSDVDEGFKR
TLKMEKDVDAFYKSKNDNSIVRDRKQEKTDRKSKHLIEQQRLKRQDMREEEQLNNEDLIS
AAVDGTGRKVKFAKDIVDSDDDMSENEVAAESDDEEDDTAFFLNPLLMSKSDGVDGGKNG
KKGKESDEEWSDDDYDNDTKDKKKKEKKGKKDLKLGKRKNREEDNDFFNNKDIEVVPQEK
FDVESDLDSDDMAETRALAKVMLRKKARTEIIDATYNRYATFDDEHELPDWFVTDEKKNF
RPNIPITKEQVMEEKKALKIYNERPSKKVTEAKARKKRRLAKAMDKIKIKAQVIAEQDIH
EGSKMRQIQKLYRKEKTKMKEDKKYVVSKNFNHVGKANVPRNMKVVDKRMKKDLKMAKIR
AKQAKKKVTKGNGKRRGPQK