Identifiers and Description

Gene Model Identifier

Contig15260.0.g63

Standard Name

SPAT3d

Aliases

Contig15260_0_g63

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13639 ) Ring finger domain
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam02891 ) MIZ/SP-RING zinc finger
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam14446 ) Prokaryotic RING finger family 1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002630305.997612587164444e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15260.0.g63(coding)
ATGCATAACAAGTTAGGTCCACGCATTCTCACTGCGGAGACAGACATTGAAATGAGCGAA
ATGGAATTGGAAGATTCGCAGGATGAAATTATTTTGGGGACAGTATTGGAAGATATCTTG
GACCTTTTCAGGTGTCCAATCTGCTTAGATATCTTTGAAATGCCTGTCAAAGTCAAAGAA
TGTGGACATCAATTCTGTAGGGAATGTGCAGAGAAGTATGGAAGACTGTTTAAACCAGCT
CATTGCGCACTGTGCAGGAACTAAATCATGACTCGCAGGGATTTAAGAATAGATATGCAG
CTAATATCCCTTATAAACAAATTCATCCCTGACGTTAGAGCTTATAAAACCAATATGTGC
AATTACTTGCAGTCTAGAAGCAGCTAACAATTATTTGAGGAAGTGTCAAGATAAGACAAG
CTTAAAATTGCTGAGATGATCATGGCTTAAAAAACATAAAACAATAATGTATAATCTGAT
TAGTCCTCATTAAAAAACCTAAATAACCAAATGGCGATGGATTCGTAAAGCGCCAAAGTT
TCTAAACTCAAAGTGAAGCAGACAAAACTAGCAAAAATCAAAGCTTTGTAACTTTAGAAA
TAGAGCAACAAAAAGGTGATGTAAGCCAAAAAATCATGTATTTTGCAAAAGAGGAAGCAG
GATGTTCTTTTCTTTCAGTAAATGATGGACAAAAAGAAAATACTTAAGCAGTATCACAGC
ACTTAACAAACAACGAACGAGGGTTAATAAAGTTTCAGTCATAGCTTATCAGATTTGATA
GTCTTAGAAACCTAACCAGAGTCTTTTCCAGTTTAACCTCAAGCACTAGAGACAACCAAA
AAGAGTAGAGACAGTCCAAAGGATACATGCAGTTATAACTTAACTCAAAGTGAAGCTATG
GTCATAGAATAAATTGAGGAGTCAGTTATCGAAATTAGAGAGTCGTAATTAGGTTTGACA
TAACAAGATAATGAAGAGTTACATATTTAAAATTAAACTTTGATGCAAAGTTAAGCTCAG
GACTTTGATTAAGAAGACTCCCAAAAGTCACTATTCCTTGATGACGATTAATCAGATAAT
AATCACGAATTTATCAATTAAGCATTGTATTCAAGAAAAGAATTTCTTCAAGAAAAAACA
ATCTCAGTCAATAAATGTTATCAAATTCAAGAGCCCAATTAACTTTTACCATAGTCTAAG
CTAAATTATAGTTTTTACATTTCTGCACATCCATTAATGATAATCAACTTCCCAAAGCAT
AATTCAAGCTTCCTTAGATCTTTAAAGAATTCTTTGTAAGTTCAGAAAAAGCTAGTGTAC
TGTGACAGGAACTTAAAGATTAAAGACTTATTTGAGACTAGTCTCAGACTAAATTATATC
TAAGACCAGGAAAACAGAAGAGAAATCAAAGGGTTTTAAGTATTTATGGCAAGAGAAAGC
AATATTGAAGGGTTTAATCATCCGCTCAAGGAGATAATTGATATGGAGACAACTATAGAT
CATATTGATAATACTATTTGGAGCAAGTATAATGAGCAGTACATAAGATTCGAAAATCCG
TATGGCCGTCTACTTTTTTACTAATACACCTTTTGA


>Contig15260.0.g63(protein)
MHNKLGPRILTAETDIEMSEMELEDSQDEIILGTVLEDILDLFRCPICLDIFEMPVKVKE
CGHQFCRECAEKYGRLFKPAHCALCRNQIMTRRDLRIDMQLISLINKFIPDVRAYKTNMC
NYLQSRSSQQLFEEVSRQDKLKIAEMIMAQKTQNNNVQSDQSSLKNLNNQMAMDSQSAKV
SKLKVKQTKLAKIKALQLQKQSNKKVMQAKKSCILQKRKQDVLFFQQMMDKKKILKQYHS
TQQTTNEGQQSFSHSLSDLIVLETQPESFPVQPQALETTKKSRDSPKDTCSYNLTQSEAM
VIEQIEESVIEIRESQLGLTQQDNEELHIQNQTLMQSQAQDFDQEDSQKSLFLDDDQSDN
NHEFINQALYSRKEFLQEKTISVNKCYQIQEPNQLLPQSKLNYSFYISAHPLMIINFPKH
NSSFLRSLKNSLQVQKKLVYCDRNLKIKDLFETSLRLNYIQDQENRREIKGFQVFMARES
NIEGFNHPLKEIIDMETTIDHIDNTIWSKYNEQYIRFENPYGRLLFYQYTF