Identifiers and Description

Gene Model Identifier

Contig1478.1.g58

Standard Name

SPAS1k

Aliases

Contig1478_1_g58

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000880107.000394035576073e-123ATPase, AAA family protein
SGDYER047C5.999840613712021e-85SAP1 SGDID:S000000849, Chr V f
rom 246503-243810, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1478.1.g58(coding)
ATGGTGACTAGCAGTTGTCAACTTATGAAAAATTAAAAAGGTAGATGCAAGGTTAAGCAG
CAGGAAGTATTGGAGGAGGTTCAAATGAGTGTAATCCAATTGTCAGTTAAAACTTAAATA
ATGGCGCTTTTAATATTTAACCACCCACTTAAGCGAAAAGTTGAGATTAGAAGGGACAGC
AAAGTGAAAATGGCTAGAAACAAAATTTCATACAGGCTTTGCAGAATCAATATTAACAAA
ATCCCTAGTAGCAATAATTTTGATATGAATGAAGACCAAAACTTCTTCAGAAATAATGAC
ACTTCAGATTAGACTTAAAACGGTTACAATAGTGTTGGAGCTAATCTATATTAACCTTCA
CATAAGTTACCAGGCACTGATTAGTCAAGCATAGCTAAAATGGACAGCAAGTAAAGAGAT
TTAATGATGTAGATCTATTCTGATCCTAATCGATTGACTTAAAATGCACGTGATAAGATT
GCTAAGATAATCGAACCAGATGAACCAACCCCAAATTTATTGGCATAGAATAACAAAAAT
CCATATGATAAAGCTGCAAATGATTTCTTGTAGCAATATTAATAGAGACCTTAACCTCCT
CCAGTATCCTAAACTGGCTAATTTGTAACGGGTTCATAGGTTAAAGCAGATATAGATAGC
ATCAGAAGAATGAATCATTAAGCTAAAAATCAGTACTATAATGATTAAAATTAAAACCAA
AGAAACTCTTATGGAGGTTTTAATAGTAATAATGGATAGTCTTGGCAAAACTCAAATAGT
AGCTATGGTGGATGGCCAAACAATTAAAATTATAATCCAAATTATTAAAATCGCTATCCA
CCACCTTATGATTAAGGTTACAACAATTATAGTAATGGACCACAGAGTTTCAACAATTAG
TATTAATATGAAGACGATAATTCAGCTACAGATAGATTTTTGAATAATTAAGGTCGTTAG
CCGGGTATAGGAGGGCCTCGAAGAAAATTCGTGGTTCCAACTAAAGAATAAAATTCTAAG
GGTTCTGGAGGAGGATAGGCTGGAGGATTTCATCCTGGCAGATCTGTTATGCAACACATG
CTAAATAATGGAACCAATCAAGAAGAAAAGAAGGAAGGAGATATAGACATATAGCTAGAT
GATAGATACAAAAATCTTGATTAAAGAATGGTAGAGTTAATCGAGAATGAAATAATGGAA
AGGCAACTTGATGTAGATTGGAATGATATTGCTGGATTGGAGTATGCCAAAAAGATAATT
TAAGAAATAATCATTTGGCCTATGCAAAGACCAGATTTATTCAAAGGTTTAAGAGCACCT
CCTAGGGGAGTCTTGTTCTTTGGTCCACCAGGTACAGGTAAAACACTATTGGGGAAAGCT
ATTTCTGCACAGACAAAATCAACTTTTATGGCAATATCTGCAAGCACTCTAACTTCTAAG
TGGGTAGGAGAAGGTGAAAAAATGGTGAGGACAATGTTTGCAATTGCAGCTATCCATCAA
CCTACAGTGATTTTCATTGATGAAATCGATTCATTGTTATGCTCAAGGAATGAAAACGAT
ATTGAATCTTCGAGAAGGATTAAAACTGAGTTTTTGGTATAACTAGATGGAGCAAACAGC
ATTGCCGGAGATGCAAGAATTTTGATTATAGGAGCTACTAATAGACCTCATGACTTAGAC
GAAGCTGTGAGAAGGCGTTTAGTTAAAAAGCTCTATATACCTTTGCCTAATAAAGCCGGC
AGAAGACAATTTATTGATAAATTGCTACTATCTGAATCTTAAAGTAATCAAAAGATCAAT
TTAGATGAACAATCCATCAACACTCTTGTAGAATTAACAAAAGGGTATTCAGGGGCAGAT
TTAAAAACTCTGGGTACAGAAGCTGCAATGATTCCACTTCGCTAAATCTCTGACATTTCA
AACATTTCAATAGATGATATAAGGCCACTTGATTTAAGTGATTTCTAGGAGGCCTTGAAA
AATGTTAAGGCTTCTGTTAATTAAAATGATTTGGAAAAGTATTTAGAATGGAATAATTAA
TACGGAAGTGTACCTTTAACAATTGATGATCTCAAAGATTGA


>Contig1478.1.g58(protein)
MVTSSCQLMKNQKGRCKVKQQEVLEEVQMSVIQLSVKTQIMALLIFNHPLKRKVEIRRDS
KVKMARNKISYRLCRININKIPSSNNFDMNEDQNFFRNNDTSDQTQNGYNSVGANLYQPS
HKLPGTDQSSIAKMDSKQRDLMMQIYSDPNRLTQNARDKIAKIIEPDEPTPNLLAQNNKN
PYDKAANDFLQQYQQRPQPPPVSQTGQFVTGSQVKADIDSIRRMNHQAKNQYYNDQNQNQ
RNSYGGFNSNNGQSWQNSNSSYGGWPNNQNYNPNYQNRYPPPYDQGYNNYSNGPQSFNNQ
YQYEDDNSATDRFLNNQGRQPGIGGPRRKFVVPTKEQNSKGSGGGQAGGFHPGRSVMQHM
LNNGTNQEEKKEGDIDIQLDDRYKNLDQRMVELIENEIMERQLDVDWNDIAGLEYAKKII
QEIIIWPMQRPDLFKGLRAPPRGVLFFGPPGTGKTLLGKAISAQTKSTFMAISASTLTSK
WVGEGEKMVRTMFAIAAIHQPTVIFIDEIDSLLCSRNENDIESSRRIKTEFLVQLDGANS
IAGDARILIIGATNRPHDLDEAVRRRLVKKLYIPLPNKAGRRQFIDKLLLSESQSNQKIN
LDEQSINTLVELTKGYSGADLKTLGTEAAMIPLRQISDISNISIDDIRPLDLSDFQEALK
NVKASVNQNDLEKYLEWNNQYGSVPLTIDDLKD