Identifiers and Description

Gene Model Identifier

Contig1836.0.g82

Standard Name

SPAS1j

Aliases

Contig1836_0_g82

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000880107.996796094675054e-118ATPase, AAA family protein
SGDYER047C1.0003926095686843e-81SAP1 SGDID:S000000849, Chr V f
rom 246503-243810, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1836.0.g82(coding)
ATGGCAACTGCGGGTATTCTACCACACAACTTATCGATTTCACCATCTCCCAATCAAAGA
GTGCCTTTCAACAACTAGGAACTACAAAATTTAGGCATACTCTCACATCTAAGCTAATTA
TACAAGCAAGCTAATGAAAAAGTCAAAATTCAAGATTGTGATGAGTAGATATTAGATCAA
AGTATGTTTTCAACAATCTCAATCGAAGATAAATGCATGAAACTTCAAAGACTGAATGAG
AAACTCCAGGCGAAGCAAGAGCAATGTGATAGTATCTAGGGCATGCAAAAATTCTTGAAT
TTTTACAATGAAAAATCAGTTGGTGCAAGAATCATCATGAGAGATTTTGCTGCTGAAAAT
GTTAGTGCATGTGTTGATAAAGCTAAATTGCAGAGATAGAAATTAATGCTAATTCATCAA
GAGAGACTAATGAAAGAAGCTTAAGAAGAGTCAAAATCATCAAACTCTCTTTTCAATCCA
GAAGAAATCGGCAAAATTCAGGTAGATTCTAGTCATGACATTCGTGCTAAATTATAGAAG
CTCCCACATATAGAAATCGCTTTGAGATTGTTAGATGAAGAAAGAGGATTAAGACCAAAA
TAAAGTGACCAGAAAAAGATTAATCCCTTGCTTGGGAATGGACTGGCTGCTCTTTAACAG
ACAACAACTTTAAACACAAAGCAGGTTGGTTAATTCAAGTCTATTGTCTAAAATTAGCTT
GGCATGACCATCAGTCAAGGCAACTACATCAACACTAAGCCTGGAAGTGGTATGGGTAAT
GAGCCTACATGGAAGTAGTATGAAAATAACCCACAGGCTTAGTAATTCATCAATCAATTC
GGTATTCAAGCACCAAAGTCAGACAACTTATCTCAAGGTACTACTTTGCCAGACTACTTG
CAAAAACATTAGAATAATTAATAAAACAAGTAGAATCAGAAGTAGTACCAACAGAACTAA
GCAAGCAATTAAGGGGGTTTCTAAAATGCTGGTGAGATGCCAACTGGAGTTAATTCATTG
CCAATGAAGAGGAATTACAATGAGACAGGTTTTGAACATGCAAATTAAAAGAACAGCTAT
CAAAATCCTTTCAATCAAAATCAAAGCAATAATCAAGTGTAACAACAATAAATTTTTAAC
ACCGCAAGAATGCCTCCTCTGTAACCTCCAGGCGTAGATCTAAATGCTTTGACCAATCTT
CAAAGATACATTGATTTGGCTGGAGGAGATGTAGATATGGGAAAAGTCTAGAAACATTTG
AAGAAGCAAAATCTTGACTTTGAATTCAATACTTATGACTAAATCAAGAAGCCAAATCAG
CCTTTAAAGAATTCAGAAGCACCCCCATAGATGTCAGGAAGCTTCATGACTGGAGGCTAA
AAATTCAATCAAGATCTATAACAGAAAAAGAAAGGCCTTGCAGGCTAGAATGATTCAAGG
ACTGTTGATGACTATTTCACTTCTAATAATAACAACCAAAGAGGAGGCAATGTTTAAAAT
AACTATGGTGGTGGGTAAGGAAAATGGGGAAATGCTTATGGCTAAGGAGCACCTCCTCAA
AAGAATCAGAATGGAGGGAATTGGGGTAATGCTTACAACAATAGCTATGGTAATAATAAC
AGTTATGGCAACTAAAATAATGGTAACTATGGATATCAAGAAGATGAGGACACTGCAACT
GATAAATTGTTCAACAATGGAGGGAGACAACCAGGTCTTGGAGGTCGTAGAAAATTTGTT
CCACCTACCAAAAGTGGACAAGGAAATGCAGGAGGTGGTGGCAGTGGAGGGTTCAATCCA
GGAAGATCAGTTACTCAGCACATGGTGAATGGTTATCAGAGTGAGGATAAGAATAAATAG
CAGCAGTAAAATGATTAGAACCAAGAGCCTGTTGACGAAAGATATAAGAACCTAGATCCT
GTTATGGTAGAAACAATTGAAAATGAGATTATGGATAGATCGCCCAATGTATCTTGGGAC
GATATCGCAGGTTTAGCAGAAGCAAAGAAAATCATAAATGAAATTATAGTCTGGCCTATG
TAGAGACCTGATATATTCAAAGGATTAAGAGCTCCTCCAAGAGGTGTCATGTTCTTTGGT
CCACCAGGGACAGGTAAAACTCTACTGGGTAAAGCTATTGCAGCATAATCTTAATCAACT
TTCATGTCAATTTCAGCATCAAACTTGACATCGAAATGGGTTGGAGAGGGTGAAAAATTG
GTGAGAACTATGTTTGCTATTGCTGCCATACATTAACCAACAGTAGTCTTCATCGATGAA
ATTGATTCCTTGCTTTGTGCAAGAAGTGAGCAAGATCAAGAATCAAGCAGAAGAATTAAA
ACGGAATTCTTGGTACAACTGGATGGAGCCAATACTTTTGCTGGAGAAAATGCTAGGATT
CTTATTATTGGAGCTACAAACAGACCTGAGGATTTGGATGAGGCTGTCAGGAGAAGACTA
GTCAAGAAATTGTATATTCCACTTCCTAACAAAGCTGGAAGGAAGTAGTTCATCCAAACT
TTGATCGAGACTGAATAGAGAAATAATGAGTCTCAACAAATAAACCTTGATGATAGAGAT
ATAGATGAGCTAGTTGAATTGACAAAGGGTTATTCAGGAGCTGACTTAAAAACTCTCTCC
TAGGAAGCTGCAATGATTCCACTTCGCTAAATCCTCGACATAAAATCAGTGAAAGCGGAC
AGTATTAGGCCTTTAGACCTTTCAGATTTCAAGGAAGCACTCAAGAATTGTAAACCCTCA
GTTAACTAGGATGATTTGCATAAATTCCTTGCTTGGAATAACTAATATGGAACTGTCCCA
ATCACAGAAGAACAACTTAAAGATTGA


>Contig1836.0.g82(protein)
MATAGILPHNLSISPSPNQRVPFNNQELQNLGILSHLSQLYKQANEKVKIQDCDEQILDQ
SMFSTISIEDKCMKLQRLNEKLQAKQEQCDSIQGMQKFLNFYNEKSVGARIIMRDFAAEN
VSACVDKAKLQRQKLMLIHQERLMKEAQEESKSSNSLFNPEEIGKIQVDSSHDIRAKLQK
LPHIEIALRLLDEERGLRPKQSDQKKINPLLGNGLAALQQTTTLNTKQVGQFKSIVQNQL
GMTISQGNYINTKPGSGMGNEPTWKQYENNPQAQQFINQFGIQAPKSDNLSQGTTLPDYL
QKHQNNQQNKQNQKQYQQNQASNQGGFQNAGEMPTGVNSLPMKRNYNETGFEHANQKNSY
QNPFNQNQSNNQVQQQQIFNTARMPPLQPPGVDLNALTNLQRYIDLAGGDVDMGKVQKHL
KKQNLDFEFNTYDQIKKPNQPLKNSEAPPQMSGSFMTGGQKFNQDLQQKKKGLAGQNDSR
TVDDYFTSNNNNQRGGNVQNNYGGGQGKWGNAYGQGAPPQKNQNGGNWGNAYNNSYGNNN
SYGNQNNGNYGYQEDEDTATDKLFNNGGRQPGLGGRRKFVPPTKSGQGNAGGGGSGGFNP
GRSVTQHMVNGYQSEDKNKQQQQNDQNQEPVDERYKNLDPVMVETIENEIMDRSPNVSWD
DIAGLAEAKKIINEIIVWPMQRPDIFKGLRAPPRGVMFFGPPGTGKTLLGKAIAAQSQST
FMSISASNLTSKWVGEGEKLVRTMFAIAAIHQPTVVFIDEIDSLLCARSEQDQESSRRIK
TEFLVQLDGANTFAGENARILIIGATNRPEDLDEAVRRRLVKKLYIPLPNKAGRKQFIQT
LIETEQRNNESQQINLDDRDIDELVELTKGYSGADLKTLSQEAAMIPLRQILDIKSVKAD
SIRPLDLSDFKEALKNCKPSVNQDDLHKFLAWNNQYGTVPITEEQLKD