Identifiers and Description

Gene Model Identifier

Contig3717.0.g24

Standard Name

SPAS1i

Aliases

Contig3717_0_g24

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000369608.999599844922746e-55ATPase, AAA family protein
SGDYPR173C3.9998411574835458e-50VPS4 SGDID:S000006377, Chr XVI
from 887837-886524, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3717.0.g24(coding)
ATGGAAACAAAGGGAATGAATGACTTTCTTACTGAGTTGAAACTAGCAAGGGAGAATTCA
ATACTTGGAAATTATGAGGACTCATTAAAGAAATACTAATCAGCTCTTTAAATTATTAAA
AATCACTTACTGATATTGAACGATAACTAACTGAAATAGAAATGGAAGATCGTAATGGAC
AACATAAACAGGGAATATGCAGGCACTAATGAAACACTCTAATTAAAGAAACAATTCTCT
AGTGGATTTGGATAGGGGTTACAGTCCAGGAAAGCAACCAATCCCATGGATAAAATGCAA
GTTAATATAATGACTCCCGATTAGAACATTCTGATGAATCCCATTGTTCCACTCCCTACT
TAAAAACGTTTGCCAAACTTTGATAGGTTTGGTGGGCAGCCTTTTTAACATCATACGGGC
AACCCTGATAATTATTTTGGTAATGACGTTGATGATCATAGTGGTGGTCAGCACATGAGC
TATGTACAGAGGAGAAATAAGAGTCAATTCCCATCTGCTAATAATCATCCATCAAGGGAG
TACAATAATGACTATGGAACTGGCAATAGAAATGAAGGAGATCCAGATATTTGGGAGCCA
CCAACACCCCCAAAGTACGGAATCCCTCCCCGATAGAGCATTATGGGTGCAGGTATGTAT
CCACCACCCCCTATGAATGGAGGTGGTGCAGGTGGCTGGGGTCAGTAGGCACCTCCTCGT
AGACAATACTAACCACAGCAGAGAAAACCACCAGTAGGAAATAACAGTGTGGCTAGACCC
TAAGGTGGAGCAGTAGCTGGTGTAAATAATAACAATAACCCTGGTGGTGCTGGAAAAGAT
AATAAAAATAGGAATTACAATAAGCCGTGGCTCTCCAATTTACCGCAACCTAACTCATAG
GCGAATAATGGGGCTAAACCAGATTAGAATACATTTTTGTACTCTATGTACCCAGATGGA
AATGGACCTGATTCTGAACTAATATAAATGCTTGAAAGGGATGTTATAGATAGAAATCCA
TAAGTAAGCTTTGACGATATAGCAGAATTAGAGGACGCAAAAAAGATTCTTTAAGAAGCA
GTATTATTGCCAATTCTCATGCCTCAATATTTTAAAGGAATCCGGAGACCTTGGAAAGGA
GTACTGATGTTTGGACCACCAGGTACAGGTAAAACTATGTTGGCCAAAGCAGTAGCCACT
CAAGATGCCATTGCTGGTGCAAGAGGTGGTAATGAGCATGAAGCAAACAGAAGAGTTAAA
GCTGAGCTACTTATATAAATGGATGGTGTGTCAGTGGTGAGTAGTGCAAGTGCAAATGAG
TAATAAGCAGATGGGGAAAGAATGAAAAATGTGATGGTTTTAGCTGCCACTAATAGACCA
TGGGACCTCGATGAAGCCTTCAGAAGACGTCTCGAAAAGAGAATTTACATTCCACTCCCT
AATGAACTTGGGAGGAAGTAATTGTTTGAAATAAACTTGAAAGGCATTAAATTAAGTGAA
GAATTTAAGATAGAGGCACTCATCAAAAAGACAAAAGGTTATTCTGGAGCTGATATCTCA
AATGTATGTAGAGATGCAGCTATGATGCCAATGCGTAAGAAAATCTTAGAAGGCAAGCTG
AACTTTGAGTAAATTGCAGCTTTGAACTAAGATGAGATCGATATCCCAATTACATAAGCT
GACTTCCTGGATGCTCTTAAGAATATAAGTAAGAGTGTTAGTAAGGAAAGTCTGGACGAC
TATTAGAAATGGATGGCTGAATTCGGTTGTGTTTGA


>Contig3717.0.g24(protein)
METKGMNDFLTELKLARENSILGNYEDSLKKYQSALQIIKNHLLILNDNQLKQKWKIVMD
NINREYAGTNETLQLKKQFSSGFGQGLQSRKATNPMDKMQVNIMTPDQNILMNPIVPLPT
QKRLPNFDRFGGQPFQHHTGNPDNYFGNDVDDHSGGQHMSYVQRRNKSQFPSANNHPSRE
YNNDYGTGNRNEGDPDIWEPPTPPKYGIPPRQSIMGAGMYPPPPMNGGGAGGWGQQAPPR
RQYQPQQRKPPVGNNSVARPQGGAVAGVNNNNNPGGAGKDNKNRNYNKPWLSNLPQPNSQ
ANNGAKPDQNTFLYSMYPDGNGPDSELIQMLERDVIDRNPQVSFDDIAELEDAKKILQEA
VLLPILMPQYFKGIRRPWKGVLMFGPPGTGKTMLAKAVATQDAIAGARGGNEHEANRRVK
AELLIQMDGVSVVSSASANEQQADGERMKNVMVLAATNRPWDLDEAFRRRLEKRIYIPLP
NELGRKQLFEINLKGIKLSEEFKIEALIKKTKGYSGADISNVCRDAAMMPMRKKILEGKL
NFEQIAALNQDEIDIPITQADFLDALKNISKSVSKESLDDYQKWMAEFGCV