Identifiers and Description

Gene Model Identifier

Contig7897.0.0.g35

Standard Name

SPAS1g

Aliases

Contig7897_0_0_g35

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003227608.99958851839629e-149ATPase, AAA family protein
SGDYPR173C9.998074580622396e-81VPS4 SGDID:S000006377, Chr XVI
from 887837-886524, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7897.0.0.g35(coding)
ATGTAGAGAATAAGCAGTGTTGGGCAATTACACAGAGTCACTTAAAAACTACAAAAAAGC
AGTGAGAATTATCCAAGAGATAACCCAGTGATTAATGACTCATTGTACAATTTGGAGCCA
AAGAAGCAGTAAATCTTACCAAAACAGCAGTCAAATGATGCGCATGACAGACAAATAAAA
GGGAAGAATTCTCATCAACAGCAGCAGTAGAACTTAGTGAATAGACAAAAGAGTCCCTTG
ATTAACAATTCCACGCCCACTCATTAGCAAAATAACAATAATTACCAGAACATCATCAAT
CCTGGTTACAGCAAGTAAAACTCAGCACCCCAGTAGTTCTAGCATTTTTAGTAATAGCAG
TAATAGCACCAGCATCAGTAGCATTCTGCTGATAACAAGTAGCAGCAGTAGAAACATAAC
AACATGCATCATAATGATCATGTGCCTGTTAACATCGTGGCTCCAGATTAAAATATTCAA
GTTAGACCTAAGAAGCAAGGAGCTGAACCTCCTCAAATAGATAGATTTGGTGGATTAGGG
CCATTTTAACATCATCATTTTAACTAGGATGATGATGACAATCAAATGAATGGTGGTTAA
GATAACAACTTTAACTAAGATTACCAAAATGACTAATACTCAGGTCAAAACGTGAATCAT
GAAATATATGTGAAGAAACCAACTTAAAATCAAGGCTAAGAAAGAAAAGACCCAGATGTG
TGGGATCCACCTACTCCAATTATTAACAATCAGAGAAAAAGTGGTGCAAAGAATCAATGG
GCAGCAAAGAAGCAATTGAATATGTAGAAACCTGGTGGTGTTGGCGGTGGCTATGGAGGA
GTCAGACCAGCTGGTGGTGGTAGAGATAATATTCCTTAGTATGGTGCAGGCATGGCTCCA
AATATCAAAGGAGTTGGGCCTCAAGTTCAAAAAGCTAATGCTTAACTAGGGAAGGCTGGT
GGTGGTGCAGCTGCAGCAGGAGGTAAAAATGATAAAAACAGAAACTATGACAAACCATGG
CTAATTCCAGAAAAGAAAGAACCACAAACTTACTTAGAATTCTGTTATCCTGATGGTGTT
GGGCCAGACGTAGATTTGATTCAAATGCTTGAGAGGGAAGTGTTAGATAAAAATCCTTAA
GTTCAATTTGATGATATTGCTGAATTAGAGGACACTAAAAAGCTGTTGCAAGAAGCAGTT
CTCTTACCAATTTTAATGCCTCAATTCTTCAAGGGTATTAGAAGACCTTGGAAAGGTATC
CTTATGTTTGGTCCTCCAGGTACAGGTAAAACTATGCTTGCTAAGGCAGTTGCTACTCAA
GGCAAGACTACATTTTTCAATGTATCTGCTAGTAGTTTAGCCTCCAAATGGAAGGGCGAA
AGTGAGAAATTAGTGAGAATTCTCTTTGATATGGCTAGATTTTATGGACCAAGTACCATT
TTCTTTGATGAAATCGATGCATTAGCATCCTCAAGAGGTGGAGGAGAGCATGAGTCAAGT
AGAAGAGTCAAGGCTGAATTACTTATTCAAATGGACGGTGTAGGGACAGTAAGTTCTGCT
TCTGCAAATGAAGCTTAAGATGACACTGAAGCCAAGAAAAATGTTATGGTTCTCGCTGCT
ACAAATAGACCATAAGACTTGGATGAAGCTATCAGAAGAAGACTAGAAAAGAGAATCTAC
ATCCCATTACCTACTGAAAAAGGTAGAGAAGAATTGTTCAAGATTAACTTGAGACATATC
CCTCTTAACGAGGACATAAATTGGTAGAAACTAGTCGATATTACTGATGGTTACTCAGGT
GCAGATATTTCAAATGTATGCAGAGATGCAGCCATGATGCCAATGAGAAGACAACTGCAG
AGCGGTTCTTTCAGCTTAGAAAATATCCAGAAAATTCAGGATGAAATTGATATTCCTTTA
TCCATGGAAGATTTCTTGGAAGCCATTAAAAACATATAGAGATCTGTCTCAAAAGATCAG
CTAAATGACTATGCAGAGTGGATGAAGATGTTTGGATCAGTTTGA


>Contig7897.0.0.g35(protein)
MQRISSVGQLHRVTQKLQKSSENYPRDNPVINDSLYNLEPKKQQILPKQQSNDAHDRQIK
GKNSHQQQQQNLVNRQKSPLINNSTPTHQQNNNNYQNIINPGYSKQNSAPQQFQHFQQQQ
QQHQHQQHSADNKQQQQKHNNMHHNDHVPVNIVAPDQNIQVRPKKQGAEPPQIDRFGGLG
PFQHHHFNQDDDDNQMNGGQDNNFNQDYQNDQYSGQNVNHEIYVKKPTQNQGQERKDPDV
WDPPTPIINNQRKSGAKNQWAAKKQLNMQKPGGVGGGYGGVRPAGGGRDNIPQYGAGMAP
NIKGVGPQVQKANAQLGKAGGGAAAAGGKNDKNRNYDKPWLIPEKKEPQTYLEFCYPDGV
GPDVDLIQMLEREVLDKNPQVQFDDIAELEDTKKLLQEAVLLPILMPQFFKGIRRPWKGI
LMFGPPGTGKTMLAKAVATQGKTTFFNVSASSLASKWKGESEKLVRILFDMARFYGPSTI
FFDEIDALASSRGGGEHESSRRVKAELLIQMDGVGTVSSASANEAQDDTEAKKNVMVLAA
TNRPQDLDEAIRRRLEKRIYIPLPTEKGREELFKINLRHIPLNEDINWQKLVDITDGYSG
ADISNVCRDAAMMPMRRQLQSGSFSLENIQKIQDEIDIPLSMEDFLEAIKNIQRSVSKDQ
LNDYAEWMKMFGSV