Identifiers and Description

Gene Model Identifier

Contig13722.0.g102

Standard Name

SPAS1d

Aliases

Contig13722_0_g102

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR173C7.996110620510222e-164VPS4 SGDID:S000006377, Chr XVI
from 887837-886524, Geno...
T. thermophilaTTHERM_009894901.0000832086161474e-142ATPase, AAA family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13722.0.g102(coding)
ATGGGAGATTTGGGAACATATCGTGAGAGAGCAAAAGTCTATGGTGAACTCGCTGCGAAA
GCTGATAATGAGAAGAGATTTTAAGAAGCTTATGATAATTACGTCAAGGCAGTAGAAGTC
TTTCAGTATATCATAAAATATGACTAGAACAAAAATCTGTAAGAAGTCTACAAGAGAAAG
TGTATTGAGTATTTAGATAGAGCACAATAGCTCAAAGAATACTTGAATAAGCTTAAAGAA
GGGGAAAGTATGAATTAAGGTGGAGGGTCCGCAGCTGCTTAAAGAAAGAAAGATGCTGGT
CATTCTAATGAAGACGAAGAGAACAAACTTTAGGATGCTTTGAGTTCAGCTATTGTTAGG
GAAAAGCCTAATGTAAAGTGGACAGATGTTGCAGGTTTAGATTAGGCAAAATCCTCTCTC
TAAGAAGCTGTTATTTTGCCAACTAAGTTCCCTCAGTTATTCACAGGCGAGAGAAAACCA
TGGAGAGGTATTTTGTTATACGGACCCCCAGGTACAGGAAAATCTTATTTGGCCAAGGCT
TGCGCTACTGAAGCTGATGGAACATTCTTCAGTATCTCTAGTTCAGATTTGGTATCAAAA
TGGCTTGGAGAATCTGAGAGACTTGTTAAGTAACTTTTCAAGTTAGCTAGAGAGAACAAA
CCTGCAATTATTTTCATAGATGAAATCGATTCTTTGTGTGGAAGTAGAAGTGAAGGAGAG
AACGAAACTTCCAGAAGAATTAAAACTGAGTTCTTGGTCTAGATGTAAGGAGTCGGAAAT
GATAACGATGGTATTTTAGTGTTAGGTGCTAGTAACGTACCTTGGGAGCTTGACCCAGCT
ATCAGAAGAAGATTTGAGAAGAGAATATATATCCCCCTACCTGATATTTAGGCAAGACTC
ACTCAGTTTAAAATAAGAATTGGCTAAACTCCTAACAATTTAACTGAAGATGATTACCTT
GAACTTGGCAGAGCAACTGAAGGTTATTCAGGGTCAGATATCACTGTAGTTGTGAAGGAA
GCTCTTATGTTTCCAATTAGAAAGTGTCAAACAGCTCAGAAGTTCAAAAAGACCTTTGAT
GGATTTATGATACCAACCTACCCATCAGATCCTGAGGGTATTGAAATGACTATCATGCAA
CTTGAGCCTAGATTGCTTAAAGCACCAGATGTAACAACAGATGATTTCTTCTAAGCACTT
GCTAGAATCAGACCTAGTGTAGCTCAGAAAGACTTAGACAGACAAATTGAGTTTACCAGT
AGTTTCGGTCAAGATGGATGA


>Contig13722.0.g102(protein)
MGDLGTYRERAKVYGELAAKADNEKRFQEAYDNYVKAVEVFQYIIKYDQNKNLQEVYKRK
CIEYLDRAQQLKEYLNKLKEGESMNQGGGSAAAQRKKDAGHSNEDEENKLQDALSSAIVR
EKPNVKWTDVAGLDQAKSSLQEAVILPTKFPQLFTGERKPWRGILLYGPPGTGKSYLAKA
CATEADGTFFSISSSDLVSKWLGESERLVKQLFKLARENKPAIIFIDEIDSLCGSRSEGE
NETSRRIKTEFLVQMQGVGNDNDGILVLGASNVPWELDPAIRRRFEKRIYIPLPDIQARL
TQFKIRIGQTPNNLTEDDYLELGRATEGYSGSDITVVVKEALMFPIRKCQTAQKFKKTFD
GFMIPTYPSDPEGIEMTIMQLEPRLLKAPDVTTDDFFQALARIRPSVAQKDLDRQIEFTS
SFGQDG