Identifiers and Description

Gene Model Identifier

Contig4615.0.1.g79

Standard Name

SP2L

Aliases

Contig4615_0_1_g79

Description

Vacuolar 14 Fab1-binding region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003788001.0000422327488734e-24hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4615.0.1.g79(coding)
ATGTCTAAGATTAAATTCCCTTAGATGGAAAATGTTAACTAATTTCGATAGGTCCTCTTG
GCATCCCTGAATAAACTTAGTGATCAGTCTACTATTAAATCAGCCACAGAGGAAGTATAT
TAATTATTGAAGGAGCATACTATAAACAATGAACGATTGAATGTTGTAATTTATCATATT
ACTGAGTTCCATGACACTATGAAGACTTTCTAAAGAAGAGAACACATTAAATTATTGGGA
GTTGCAGCTGAGATATACTAAGATAAACTTATTCAATACATGCCTAAAATACTTGCTTTC
TATAACAAACGCATTAAGGATTCTGATTAAATTTTGCACCCTGTAATTGCTGAAACTATG
GGTACTCTAACCCACTAATTATTGAGAAATACTGAAGATACCTAAGTTATCCAGGATCAA
ATTGCACAAATATTGAAACAAGTCTATTTCTCGATGTTACAATCGAATAAAATCTAATAA
TTGTGCGCATCTTAATTGGAGAAAGATATCTAGCAGCAAGTACCACAATTTATGCAACAC
ATAATCACTTGTATGGAAAACACAGAGTTTTCAACTAGAAAAATGGCAATTGACACTATA
CTCACACTCGCTAAAGTTCATCCAATGTGTCTCAAGCCATATAGGAAAGAAGTTAACAAT
ATCCTTAATGAACTTAGATTCGATAAGATAAAACCTGTGAGAGATTCATCGCTTGATGTG
TTGAACTTATTTAAAGAAATCCCAGAGCTTTATTACAGCGAAGAGGAAAGGCTTAGAGAG
GAAGAAATTAAAGAATAGCAAAAACTATAAAAATAGTAAAAGTAATAAGAGATTAAGAAA
GATTTGGTAAAGAGAAATCCCAGAGTAATCCCCAATGTGGATTAAGACACAACTGTAACA
ATAAATGGTGTGGTATTTTCAGGTGTCGAAGGAGGAGGGTAAACCTTGAAATAAAAAGGA
AAATAATTAAAAGACAAGGACTAAAATGATTAACAGGACAAATATCAACTAGGATCCCCT
ACGAGTGAAGGTTAGAACAGCAAGAAAGTGTCAACAGCCACTTAAAAGCGCAGAGAAGCA
AAAACAAACAAAAAGCACAAGAATTTTACACAGAGCAGTGGGGAGGACTCTCAAAGAGAA
AAGCGTGAACATGAGAGCATATTCAAGAGAAACTCTATTAATCAGGAATTTCTACAAAGT
GCAGGAAAAGCTCAAAATAAACGAGGTGGCATTGAAATATTTGCACCAGATGGGGCAGTT
GAGGAGGAATTCGAGGAAGACGATGAGCAGGTTGAGCTTTAGAATAATGATAGTGACTTA
AATAACTTAAATGACGGTGATGAAGAGAGCATTGATAAAATCAAGTAAGATAAGACTCCA
GGGGCTGATGGTGGAGATCAATCGAACAGAGGGTTTGCTAAGAATAATAATCTCAAAGTG
TCAGCTAGAGATTACAATTCTAATTAGTTGAAGGAGGAAGGATTTCCTCAAATGACAACT
ATTCAGCATGGTGATAATGATGATGATAATGTATTGTTGACAGAAGACCAAAGACAGCAT
TTCTTAGTGAGCACAAATAGAAGAACTGATAATGAAAAATATTAAAATCTACTTGGTAAT
AACAGGCCAAGTCTTTAAAACAGTCAAATCATAGAATTGGAAGAAGAACACAGAGATTAC
TAAAACTCTGGTTAATCAGATAGGAGACGCTATGAAGATGATGGAGATTCTCAGCAAAAT
CAATCATTTAGAGAAGCTGGATATTCCAGCAGAAGGCCTTAAATAAAGCCATATGGTCAG
CAATAGATAAATGATGATAGTAGTTAGAGTAACACTCAGAGAGGAGACAGATAGAGCTAA
CATCCATAAATTCTCAGCTAAAACTAATAGTAATCGTTGAAATATGTGCTGATGGAAATT
CAAAAGATTTCTCAACAACAAGCTCGCATGATGGATGGCATGTAAACTTTTCAAAATTTC
GCAAGAAATGAGCTTGCTGGTTTGAGATAAAGAGTGCATGTTATGGATTAAAAAGTCACT
TCAGTTTACTACATGAAAAACGGGAGATATCCACACCTTAATAATTCATAAATGCATAAT
GCAGCACCACCAGGATACGGAGTATAATAATCAATGAATATGCAGATGTATGATTCCATC
GTTAATGTTCCGCAAAGAGTTTCTAATTTTGAAGGAGGAAATTAATAATAATTGTCTGGC
AGAGGGAGACCAAATTAAAACTTCAGGGATTAGAGGTCTCCAGAAAGGTAGCCATACTAA
AATCAGTCGTCAATGAGACTGACTTAGAATTTCAGTTAGTAAACAGATTGGTCAACTATA
TAATAACTACTTTCTAATAATCAAGTCTCCGAAGCATATTAACTGGCAATCTCAAACTCA
GACGATGACTTACTGCTGATTAAGCTAATGGGCAAGACAGGTATATGTCTACAGTAACTA
CTAGATGACCAATAACAATCATAAAGCAAAAATCGTAGAGGATAGCAGCAACAGCCAGTT
CTATCAAATTTAGTAGAGATTTTGATTTAGAAAATTATAGCAATATTAACTACAAAAGAA
TTCGTGAATGTCTTATTGCCATGGATTACAGAACTCAGTGATATACTTGTTGACAACAAG
CAAGACAATAGGGGTTAGGCTTTAGACCCTGAGTAGATAGTATCACAACAAGTAGTTTCA
GATTTAATTGAAGTATTGATTGGATTAATGAACGATGTAAAAAGTGGAATCGATGAATTA
CAGAAGAACGAAATCCAAAGAATTTCAGAAAATTTATCATTCGCTTTCAAATCATGA


>Contig4615.0.1.g79(protein)
MSKIKFPQMENVNQFRQVLLASLNKLSDQSTIKSATEEVYQLLKEHTINNERLNVVIYHI
TEFHDTMKTFQRREHIKLLGVAAEIYQDKLIQYMPKILAFYNKRIKDSDQILHPVIAETM
GTLTHQLLRNTEDTQVIQDQIAQILKQVYFSMLQSNKIQQLCASQLEKDIQQQVPQFMQH
IITCMENTEFSTRKMAIDTILTLAKVHPMCLKPYRKEVNNILNELRFDKIKPVRDSSLDV
LNLFKEIPELYYSEEERLREEEIKEQQKLQKQQKQQEIKKDLVKRNPRVIPNVDQDTTVT
INGVVFSGVEGGGQTLKQKGKQLKDKDQNDQQDKYQLGSPTSEGQNSKKVSTATQKRREA
KTNKKHKNFTQSSGEDSQREKREHESIFKRNSINQEFLQSAGKAQNKRGGIEIFAPDGAV
EEEFEEDDEQVELQNNDSDLNNLNDGDEESIDKIKQDKTPGADGGDQSNRGFAKNNNLKV
SARDYNSNQLKEEGFPQMTTIQHGDNDDDNVLLTEDQRQHFLVSTNRRTDNEKYQNLLGN
NRPSLQNSQIIELEEEHRDYQNSGQSDRRRYEDDGDSQQNQSFREAGYSSRRPQIKPYGQ
QQINDDSSQSNTQRGDRQSQHPQILSQNQQQSLKYVLMEIQKISQQQARMMDGMQTFQNF
ARNELAGLRQRVHVMDQKVTSVYYMKNGRYPHLNNSQMHNAAPPGYGVQQSMNMQMYDSI
VNVPQRVSNFEGGNQQQLSGRGRPNQNFRDQRSPERQPYQNQSSMRLTQNFSQQTDWSTI
QQLLSNNQVSEAYQLAISNSDDDLLLIKLMGKTGICLQQLLDDQQQSQSKNRRGQQQQPV
LSNLVEILIQKIIAILTTKEFVNVLLPWITELSDILVDNKQDNRGQALDPEQIVSQQVVS
DLIEVLIGLMNDVKSGIDELQKNEIQRISENLSFAFKS