Identifiers and Description

Gene Model Identifier

Contig21348.0.g48

Standard Name

SNW1

Aliases

Contig21348_0_g48

Description

SKIP/SNW domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009429908.001307376279851e-107SKIP/SNW domain containing pro
tein
SGDYAL032C9.001232279470736e-16PRP45 SGDID:S000000030, Chr I
from 84474-83335, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21348.0.g48(coding)
ATGAAAACATATTCAGTTGTGAAGTACGACGGCCTGGCCAACCCAAACAAGAGTCAAAGA
GATTTATAGAATGCTGACTTAACTAGACCCTCAGAAGAGACAAGACTAGTTAACTTGGAG
AAGACCAGGCAAGAGTTGAATGTATCAGTCTCTAAGAAAATTGAACCAGCTTTTGTCACA
TCAGTTGCGCACAAGTCTTAGAAAGATATCTAGTACGTTAGATACACTCCACAAAATTTG
AATCCTCATCAGTAGTCACAATAGAGAATTATCTAAGTTTCTACAGTTCAAGAGGATCCC
CTTGAACCCCCTAGGTTCAAGCATAAGCGTATAATGAGACCTCATGGTAGTCCTCCTCCC
TAGATAAACCGCAGCCCCCCAAGAAAGTTGACTAACAAGGACATGCAGGATTGGAAAGTT
CCTCCATGTATATCAAACTGGAAAAATGCTAAGGGATTCACAATTCCACTGCACATGAGA
CTTCAAGCAGACGGAAGAGGCATGCAAGACAACTCTATTAACGAGAAGTTTTCATCATTT
ACTGATTCACTCTATACAGCAGAAAAGCAAGCTAGAAAAGAGGTTGAAGAGAGAAGCAAA
ATCTAAGAGACCATAAAGATGGCTTTAGCAATGAAAAAGGAAAAAGAAATCAAGCAAGCT
GCTACTTTGGCAAGAGCTGAGAAGGCAGGTCTTATGGCAAGCTCTATTTCAAAATTCAAT
TCAGAGTTAAGAAAGGATACCGAGGACATTTCTGGCAAAAAGAGATCTAGAGAGGAGAAA
GATCTTGAGGAAGCTAAAAAGGAGAGAGATGACCTTAGATATCAGAGGAAACGTGAAATT
GAAAGAGACCGCAGAATGGAAGTCGCTGGAAAGAAAAAGTCAAAGACCACTCGTGATGAG
GAGAGAGACATTTCTGAAAAGATAGCTTTAGGACAAGCTCAGCCAACTTCACGTGAGGCA
ATGTTTGATTAGAGATTATTTAATCAAGCAAGTGGCTTAGACTCTGGCTTTGGAGAGGAA
GACGACTACAATCTCTATGATAAACCACTCTTTGCAGACAGAACTGCTGCTTCAATTTAC
AAAAATGTGAAGGAGGTTAATGATGACGACGATAACGACCAGTAAGCAGATTAAGGAGCT
GAGGCTAAATAGACTGGTGGTCAGAAGCCAAACAGAGGATTTGAAGGCACTGATTATACC
AAAGGAGCTCGTGCTAAGCCTGTGGAGTTTGAGAAGAGACTTTTGGGAGAGGATAATGCT
TTTTCATAGGCAGGACTTCATGATGGCTCTCAACCAAACAAGAGACAGAAATAGTGA


>Contig21348.0.g48(protein)
MKTYSVVKYDGLANPNKSQRDLQNADLTRPSEETRLVNLEKTRQELNVSVSKKIEPAFVT
SVAHKSQKDIQYVRYTPQNLNPHQQSQQRIIQVSTVQEDPLEPPRFKHKRIMRPHGSPPP
QINRSPPRKLTNKDMQDWKVPPCISNWKNAKGFTIPLHMRLQADGRGMQDNSINEKFSSF
TDSLYTAEKQARKEVEERSKIQETIKMALAMKKEKEIKQAATLARAEKAGLMASSISKFN
SELRKDTEDISGKKRSREEKDLEEAKKERDDLRYQRKREIERDRRMEVAGKKKSKTTRDE
ERDISEKIALGQAQPTSREAMFDQRLFNQASGLDSGFGEEDDYNLYDKPLFADRTAASIY
KNVKEVNDDDDNDQQADQGAEAKQTGGQKPNRGFEGTDYTKGARAKPVEFEKRLLGEDNA
FSQAGLHDGSQPNKRQKQ