Identifiers and Description

Gene Model Identifier

Contig12739.0.g72

Standard Name

SNUPNb

Aliases

Contig12739_0_g72

Description

mRNA capping enzyme, catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01331 ) mRNA capping enzyme, catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004207404.0002685161515803e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12739.0.g72(coding)
ATGGAGACTATTAATAGCACAACTGACAAAATCTAATAAGATACCTAAATTTAAGCTGTA
GTCTAGCCAAACATATTAGGAGCTTAAAATTTCCCTATTTTCAACCCAGAATAGCAAAAT
GCATTAAGCTTCTATAACCCTCAAACGAAGGCTGACTAAATTGCTTTAGAGAGAACCTAA
TGGTTCAACTAATCAGCATCTCTAGAAAATTTAATGAAAGACAGAAAAGAAAAATTAGTA
ACAATGCAAAGAGAGAGAAGATAGTAGCATTTATATGACAAGAGAAAAATCAATGACTTC
ATTTTTGAAGATGCTTAGAATAACGTAAATAGTAAAAATTCAATGGAGCTTTCAAAAAGT
AAAAGTTCTGGAGTTAGCAGTGTGATGGATTTGGATAATTTCAATGAGTAGAATCCATTT
CAAACTTAAGAGCAAACATATTAAGTGGAAGATACTGAGTTTTAAGAGGATATGACATAC
GAGTTTAAATAAAATAAGCCTTAACAGTATCAGAAACGCAAAGACAAAGATAAAGGAAAT
AATAGACTTTACTATGCTTAGTAATTACAAACTCACGATTTCTTACTACGATAAGACCTT
GCAATCGTGCATGATTCTAACTTCTTAATTTACCCAAGACCTGTAGGATAAAGATGCTTA
GTTACCTCAGCCAAAGGTAACACAATTGCTCGCAACAATCAAGGCTTTATAAAAATTTAA
TTCTAAAGTCCATTACCAAACGGATCAAGAAAATAGAATAATTAAGAGCTGAACCAGTTT
TCTACTTAAAATGGCAGGCATTGTGCAGTACTGGATTGTATAATGATTGATAGCTAGAAA
TTATTTTATGTAATTGATATAATGTTCTGGGAAGATATGGATTACTCAGAGTTTCCTCTT
TGCTCAAGATTGTTGTTTATGCAGTAAAAATTCCAGGAAATCAAAGATTTGAACTCAGAT
CTATACGAATATAAATTCAAGCTCATGGAATTTCAACCCTGCAATTCAAAGAATTTATTG
GGTGCCATATATGGAGATGTATTAGCTGAGTATGTGAACTATCAAGAAGTAATCAAGCTT
AATGGAGATTATGAGATATATGTTGACGAAGAAAAATTACTACAAGATCTTAAAAAGTCA
GATTCCTAAATTTCTATTTACTACAAGCAATTAATATAAAAACTGTCTGATCAAAAAGTT
AAATTAAACGAAGCAAAACTGCAGTCGGATCTTCCTTATGCAATAAAATTGATGTAGCTC
TATATTTTTGATAGTTAAATGATTTTAGCTATAGAAAAAGATGGAATTATTTTCAATCAC
ATAGAGAGTGCTTATGAAAAAGGTTTAAATACTCTTGTACTTCATTGGAGAGATCCTTCT
ATCTCTAATTATTGCAGTAATGATGAGGATGAATATGGCTTAATTCAAACTGTGCTAAGA
CTTACTGATGACTATAACTTTGAGACTTATGATGGAGAAGTACTTGAAGTATCTATTAAT
TGCAAAAACACAGAGTGTATCATGAATCTGGACCCCTAAAACATTTACAACCTAAAGATT
AAAATCTAAACAGTCTTGTCTGATCCATAGCCAGATATTGGAGATTCAAAACCATAAGAA
ATTAACATACCAACTTCCAAGATTGAAATCGTAGAAATCCATTTAAGCCAAAGGACCTCA
AAGATAATCCCAGATCATCTTTCAAAAATAATTTCCAAGTCTTTGCATCTTCAAGGTGAA
AATATAACTGCTTCAAAAATTATTAGAGCAATTGAGAGTAATGAAGAACCATTGCAATCA
CTTTCAACAAAATCACTTAGTATGAACGATGGAATGATGAGTGACTATAATTATGGGTAA
AGTGCACTCGGACAAACATTTAGTAATAATTCGAATAAGATGAGTGATATCTGA


>Contig12739.0.g72(protein)
METINSTTDKIQQDTQIQAVVQPNILGAQNFPIFNPEQQNALSFYNPQTKADQIALERTQ
WFNQSASLENLMKDRKEKLVTMQRERRQQHLYDKRKINDFIFEDAQNNVNSKNSMELSKS
KSSGVSSVMDLDNFNEQNPFQTQEQTYQVEDTEFQEDMTYEFKQNKPQQYQKRKDKDKGN
NRLYYAQQLQTHDFLLRQDLAIVHDSNFLIYPRPVGQRCLVTSAKGNTIARNNQGFIKIQ
FQSPLPNGSRKQNNQELNQFSTQNGRHCAVLDCIMIDSQKLFYVIDIMFWEDMDYSEFPL
CSRLLFMQQKFQEIKDLNSDLYEYKFKLMEFQPCNSKNLLGAIYGDVLAEYVNYQEVIKL
NGDYEIYVDEEKLLQDLKKSDSQISIYYKQLIQKLSDQKVKLNEAKLQSDLPYAIKLMQL
YIFDSQMILAIEKDGIIFNHIESAYEKGLNTLVLHWRDPSISNYCSNDEDEYGLIQTVLR
LTDDYNFETYDGEVLEVSINCKNTECIMNLDPQNIYNLKIKIQTVLSDPQPDIGDSKPQE
INIPTSKIEIVEIHLSQRTSKIIPDHLSKIISKSLHLQGENITASKIIRAIESNEEPLQS
LSTKSLSMNDGMMSDYNYGQSALGQTFSNNSNKMSDI