Identifiers and Description

Gene Model Identifier

Contig9791.0.g65

Standard Name

SNUPNa

Aliases

Contig9791_0_g65

Description

mRNA capping enzyme, catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01331 ) mRNA capping enzyme, catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004207404.0002685161515803e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9791.0.g65(coding)
ATGGAGACTATTAATAGCACAACTGACAAAATCTAATAAGATACCTAAATTTAAGCTGTA
GTCTAGCCAAACATATTAGGAGCTTAAAATTTCCCTATTTTCAACCCAGAATAGCAAAAT
GCATCAAGCTTCTATAACCCTCAAACGAAGGCTGACTAAATTGCTTTAGAGAGAACCTAA
TGGTTTAACCAATCAGCATCTTTAGAAAATTTAATGAAAGACAGAAAAGAGAAATTAGTT
ACAATGCAACGAGAGAGAAGATTGTAGCATTTATATGACAAGAGAAAAATCAATGACTTC
ATTTTTGAAGATGCTTAGAACAACGTAAATAGTAAAAATTCAATGGAGCTTTCAAAAAGT
AAAAGTTCTGGAGTGAGCAGTGTGATGGATTTGGATAATTTCAATGAGTAGAATCCATTT
AAAAATTAAGAGCAAACATATTAAGTAGAAGATGCTGAGTTTTAAGAGGATATGACATAC
GAGTTCAAATAAAATAAGCCTTAACAGTATCAAAAACGCAAAGACAAAGATAAAGGAAAT
AATAGACTTTACTATGCTTAGTAATTACAAACTCACGATTTCTTACTACGATAAGACCTT
GCAATCGTGCATGATTCTAACTTCTTAATTTACCCAAGACCTGTAGGATAAAGATGCTTA
GTTACCTCAGCCAAAGGTAACACAATTGCTCGCAACAATCAAGGCTTTATAAAAATTTAA
TTCTAAAGTCCATTACCAAACGGATCAAGAAAATAGAATAATTAAGAGCTGAACCAGTTT
TCTACTTAAAATGGCAGGCATTGTGCAGTACTGGATTGTATAATGATTGATAGCTAGAAA
TTATTTTATGTAATTGATATAATGTTCTGGGAAGATATGGATTACTCAGAGTTTCCTCTT
TGCTCAAGATTGTTGTTTATGCAGTAAAAATTCCAGGAAATCAAAGATTTGAACTCAGAT
CTATACGAATATAAATTCAAGCTCATGGAATTTCAACCTTGCAATTCAAAGAATTTATTG
GGTGCCATATATGGAGATGTATTAGCTGAGTATGTGAACTATCAAGAAGTAATCAAGCTT
AATGGAGATTATGAGATATATGTTGACGAAGAAAAATTACTACAAGATCTTAAAAAGTCA
GATTCCTAAATTTCTATTTACTACAAGCAATTAACATAAAAACTGTCTGATCAAAAAGTT
AAATTAAACGAAGCAAAACTGCAGTCGGATCTTCCTTATGCAATAAAATTGATGCAGCTC
TATATTTTCGATAGTTAAATGATATTAGCAATAGAAAAAGATGGAATTATTTTCAATCAC
ATTGAGAGTGCCTATGAAAAAGGCTTAAACACTCTTGTGCTTCATTGGAGAGATCCCTCT
ATCTCTAATTATTGCAGTAATGATGAGGATGAATATGGCTTGATTCAAACTGTGCTAAGA
CTTACTGATGATTATAACTTTGAGACTTATGATGGTGAAGTACTTGAAGTGTCTATTAAT
TGCAAAAACACAGAGTGTATCATGAATCTGGATCCCTAAAACATTTACAACTTAAAGATT
AAAATCTAAACAGTCTTGTCCGATCCACAGCCAGATGTTGGAGATTCTAAGCCATAAGAA
ATTAACATACCTACTTCCAAGATTGAAATTGTGGAAATCCATTTAAGCCAAAGGACCTCA
AAGATAATCCCAGATCATCTTTCTAAAATAATCTCCAAATCTTTGCAGCTTTAAGGTGAA
AACATAACTGCCTCAAAAATTATTAAAGCAATTGAGAGTAATGAAGAACCTTTGCAATCA
CTTTCAACAAAATCCCTTAGCATGAACGATGGAATGATGAGCGACTGCAATTATGGGTAA
AGTGCACTCGGACAAACATTTAGTAATAATTCTAATAAGATGAGTGATATTTGA


>Contig9791.0.g65(protein)
METINSTTDKIQQDTQIQAVVQPNILGAQNFPIFNPEQQNASSFYNPQTKADQIALERTQ
WFNQSASLENLMKDRKEKLVTMQRERRLQHLYDKRKINDFIFEDAQNNVNSKNSMELSKS
KSSGVSSVMDLDNFNEQNPFKNQEQTYQVEDAEFQEDMTYEFKQNKPQQYQKRKDKDKGN
NRLYYAQQLQTHDFLLRQDLAIVHDSNFLIYPRPVGQRCLVTSAKGNTIARNNQGFIKIQ
FQSPLPNGSRKQNNQELNQFSTQNGRHCAVLDCIMIDSQKLFYVIDIMFWEDMDYSEFPL
CSRLLFMQQKFQEIKDLNSDLYEYKFKLMEFQPCNSKNLLGAIYGDVLAEYVNYQEVIKL
NGDYEIYVDEEKLLQDLKKSDSQISIYYKQLTQKLSDQKVKLNEAKLQSDLPYAIKLMQL
YIFDSQMILAIEKDGIIFNHIESAYEKGLNTLVLHWRDPSISNYCSNDEDEYGLIQTVLR
LTDDYNFETYDGEVLEVSINCKNTECIMNLDPQNIYNLKIKIQTVLSDPQPDVGDSKPQE
INIPTSKIEIVEIHLSQRTSKIIPDHLSKIISKSLQLQGENITASKIIKAIESNEEPLQS
LSTKSLSMNDGMMSDCNYGQSALGQTFSNNSNKMSDI