Identifiers and Description

Gene Model Identifier

Contig18406.0.g85

Standard Name

SNU23

Aliases

Contig18406_0_g85

Description

Zinc-finger double-stranded RNA-binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam12171 ) Zinc-finger double-stranded RNA-binding
  • ( pfam12874 ) Zinc-finger of C2H2 type
  • ( pfam06220 ) U1 zinc finger
  • ( pfam12756 ) C2H2 type zinc-finger (2 copies)
  • ( pfam13339 ) Apoptosis antagonizing transcription factor
  • ( pfam06746 ) Protein of unknown function (DUF1216)
  • ( pfam03961 ) Protein of unknown function (DUF342)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000594402.0002795641672355e-21hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18406.0.g85(coding)
ATGGGAAATGGAAAGAATCAGCCACCTCCTGAAAAGAGAAAGTTATTGCAGGCAGTTGAC
AGAGATGCGATTAAACCCGAGGAATTAGTAGGCAAAGAATTCACAATTACGGCTTAAACT
GAGGAAGAAAAGCAATCAGCATTTTACTGCAAAACTTGCAAAGTACAACTCAAAGACTCT
AATGCATGGTATGATCACATTAATGGGAAAAAGCATAATTAAATGTTGGGAATGTCTATG
GTTGTCGAGAAAGTAGGCTTGGACAGAGTAAAAGCTAAATTAGCAGGACTAAAGAGGAAA
GCAACTACCACTGTTGAGACTATTGAAGATATTGAGAGGAGACTTGATTAATAAGAACAA
GAGGAAAGAGAGGAGAGAGATAGGAGAAATAAGAGAAAGAAGCTAGATGATTAACAGTAG
TTGAAAGAAAGAGTACAGGAAGAGTTAGAATTTAATGAAGAAGATATTACTGCATTTGGA
CTACCAATGGAATTTGGAACTGCTAAGAAGAAGTGA


>Contig18406.0.g85(protein)
MGNGKNQPPPEKRKLLQAVDRDAIKPEELVGKEFTITAQTEEEKQSAFYCKTCKVQLKDS
NAWYDHINGKKHNQMLGMSMVVEKVGLDRVKAKLAGLKRKATTTVETIEDIERRLDQQEQ
EEREERDRRNKRKKLDDQQQLKERVQEELEFNEEDITAFGLPMEFGTAKKK