Identifiers and Description

Gene Model Identifier

Contig11435.0.0.g86

Standard Name

SNU13

Aliases

Contig11435_0_0_g86

Description

The ARF-like 2 binding protein BART

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam11527 ) The ARF-like 2 binding protein BART
  • ( pfam01248 ) Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006287092.0005131442217614e-4050S ribosomal protein L7Ae, pu
tative
SGDYEL026W1.0002335610448659e-38SNU13 SGDID:S000000752, Chr V
from 101943-102323, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11435.0.0.g86(coding)
ATGGATAAAAAGAGTAAGAGCAGTAAGAAGCAAGATAAGCAAGAAAAGGTCGAAGTCGCC
GCTGAGGAGAAGTCAAGAGCCTGGCCCAAGGCTGACAACCAGCTATAGAAGCAGATCTTG
GATTTGTGCAACTAGTCAGTTCTTTACAAGCAATTGAAGAAGGGAGCCAACGAGAGCACA
AAAAGTTTGAACCGTGGTGTTGCAGATTTGATTATATTGGCCGCTGATACCGAGCCACTC
GAGATCATCTTGCACTTGCCACTTTTGTGCGAGGACAAGAACGTCCCCTACGTGTACGTC
GGCAAGCAAGCCGACCTTGGAAGAGCATGCGGTGTCTCCAGAAACATCGTAGCTGCATGC
ATCTTGCATCACCCAGACTCACAATTGCAAAGTCAAATCAACGAGATGAAGGATAAGGAT
TGGTTCTTCGACATAATCATAAACTTCTTGAGGTCTCCAAGATGGAAAACTCCTATTATG
CAGTTTTTAGATGAGAATTGTATAATCTTTGATAATGAAGAAGAAAACAGACTTGAGTAT
ACTTCCATTCACATGTCTTTCAAGAAAATCGTTGATGATTTATTGAGTGAACTCATGAGG
GAATTAGGAGTGACTGAAGATTAATTTATGGAAGCTTGCGAGAAAGCAGCGGCCAATCCT
CTTCATAAGAAGATTGTGGACTAAATCACAGCAGTTGAAAATTTCACAGCCTTCAAGAAA
CTTATGGTCAAGCGTAACTAGGAACTTAATCAGCAAGCCATGTAAATGATGAGCAAGAAG
GAAGAAGTTAAAGATGATGGATAGATGACGGCAAATCCTTAGAGTAGAGAACCAAAAACC
AAAGCTAAAGCTCAGGGAACTATAAGCTAACAAACTCTACCGACTCCTAAAATGAGTAAA
GAGTAAAAGGAGGCATTTAAAATAGCATAGGAAGAAGAATCAAAAGCAGAGGAAGAGATG
GTCAGGAAAGCCATGGAAATATCGATGCAGCTAGATTAGTAAATGAAATAGGAGATTGAT
GAGGAAGAGGAGATGATAAAGCGTGTCATGGAACTCAGTGAATAGGAAGAAAAGCTGAGA
CAAAAGAAATTGAGGGAAGAAGAGGATAACATTAAAAGAATAGCTGAGTAAGAAGCTGGA
AGATAGGCCGAGGAGGAAAGAATAAGAAAAGCAGAAGAGGAAACTAAGAAATAAATGGTA
TAGGCATAGTAAAAAATAAAGGAATAGGAGGAAGTTAAGGTTTAGGTTCAAGCTCAAGTT
GAATTTAGTCCACAAGAGTAGCATCATGATGCCGCTTAAACAGATATGATAAAGCCTCAA
AAGAAACAAAGACTACCAAAATAAGAGCTGGAAAAGACTCAATCTCATGTTCAACCACCC
ACTGAAAAGATTCAAAGCAAACTACCTGATATTTAAAAACAAAAAACTTAATTTGACTTA
CCACCAGTGTAAATGAAGAGAGGAGGAGGTTTCGATTTCGACAACGATATCCTAATAGAA
CAGCAAAAGAACATCAATAAAATGAATGCCATGAGAGAATTTGATGAAATGGAAGACCAA
TAAAATAAGAAGCATGGCTAGGAAGAGTCAAAAAGTTTAAGTGACATGCTAAAAGAAAAG
AGAGAAAAGAATGAGCAATTCATAAATTCCAAACAACCAACTTCATAGCAAGAGAGTGTT
GAAGATAGGAAGAAAAGATTGTAAGCTTAGAGGGATATTCTCATGAAACAGAAAGCTGAT
AAGAGAGGGAAAGAACTCGAAGAATTCAAGGAAAAAACTAACAATCAATAAGATCTTCAC
AAAGAGCTCTTAGAACTTGATAAGAAAACAAAACTAAAGGCATAAGCGAAAGTTGGCATG
TAATTCGGATCCTCGCCATCTAAAGATAACTTTGATGAGATAAACTTGAATGATCATTAG
GAGGTTGACAAGAGATTAAAGATTTATGAGAATATGCAGAAGCAGGTCAACACGCTAAAA
TGA


>Contig11435.0.0.g86(protein)
MDKKSKSSKKQDKQEKVEVAAEEKSRAWPKADNQLQKQILDLCNQSVLYKQLKKGANEST
KSLNRGVADLIILAADTEPLEIILHLPLLCEDKNVPYVYVGKQADLGRACGVSRNIVAAC
ILHHPDSQLQSQINEMKDKDWFFDIIINFLRSPRWKTPIMQFLDENCIIFDNEEENRLEY
TSIHMSFKKIVDDLLSELMRELGVTEDQFMEACEKAAANPLHKKIVDQITAVENFTAFKK
LMVKRNQELNQQAMQMMSKKEEVKDDGQMTANPQSREPKTKAKAQGTISQQTLPTPKMSK
EQKEAFKIAQEEESKAEEEMVRKAMEISMQLDQQMKQEIDEEEEMIKRVMELSEQEEKLR
QKKLREEEDNIKRIAEQEAGRQAEEERIRKAEEETKKQMVQAQQKIKEQEEVKVQVQAQV
EFSPQEQHHDAAQTDMIKPQKKQRLPKQELEKTQSHVQPPTEKIQSKLPDIQKQKTQFDL
PPVQMKRGGGFDFDNDILIEQQKNINKMNAMREFDEMEDQQNKKHGQEESKSLSDMLKEK
REKNEQFINSKQPTSQQESVEDRKKRLQAQRDILMKQKADKRGKELEEFKEKTNNQQDLH
KELLELDKKTKLKAQAKVGMQFGSSPSKDNFDEINLNDHQEVDKRLKIYENMQKQVNTLK