Identifiers and Description

Gene Model Identifier

Contig10745.0.g98

Standard Name

SNRPGc

Aliases

Contig10745_0_g98

Description

Putative serine esterase (DUF676)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam05057 ) Putative serine esterase (DUF676)
  • ( pfam06028 ) Alpha/beta hydrolase of unknown function (DUF915)
  • ( pfam12695 ) Alpha/beta hydrolase family
  • ( pfam12697 ) Alpha/beta hydrolase family

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10745.0.g98(coding)
ATGATTGAGAGAAGTTTCAACGACCCCGATCTCTGGAACAATGATCATCCCATAATCTTG
GTTCACGGGTATTGCGGATCAACAATGGATGAGAATTGGATTTTAGGTGGCTATTTTCAC
TATGCATTCTCTAAAACAGCTCGATATCTGGGCATAGACGAATAAACTCTTTAACCCATC
TACATGAATAATATCTATGAGGCTGACGTTTCTCCCATAGGTAGTGCTTTTGACAGAGCT
TGTGAGCTTTACTAGTAAATCATTGGGGAGGAGAGAATTAGGTAAATTGCATAAGAGTAA
GACATATCACTGGCGGAGGCAGTTTATGGGAAGACGCATGTCAAAGATCATCATCGAAAT
AAGTTCTATAAAATAAAATACTTAAAGACTCAAGAAGCGGAAAGTAAAAGAATGTACGCT
TTTCCAAATGGGCTTCCTGGATGGAATAATGAAAAAATAAAGAAAATACATTTTGTAGGG
CATTCGATGGGTGCTATAACTGTTCGCTACTTTTAATACCTGCTTGAGATCGGTTACTTT
GATGAAATTGCTGGAAAACCTAAATCAGATAAAAGTAAAATAGTTGCCTCTCTTACATGC
TTAAGTGGGGCGAACAATGGTTCTTTAATTGTAAATAACTGCGGTTTATAGTATGATAGA
GAACTATCGGACTGGATACTTAAGAAAAATGGAAGAATGATTTTGGCTTTTAAAATGAAT
GTATTCTTTCAAAATATCTACTAATCTCAGAATTATTAACTGGAGAGAATATATAGAAAA
ATATTAGAAAATGATGGGACTCATAAATACGAATTGAGTTATCAATATTAGAATCCTATA
CTCTATGATATGAATGTGGAGATGTGGGACTGGAACAGAAAAGATAACGAATCTAGATAT
AATCACTTAACGAGGCTATATAATGAACAATTCCAGGTAGAATCGAAAGATCTCTCCTTT
GTTGATTTAAACCCTTAAGGACTAATAAGACTCAATCAATTTTTAAAAACCAATTAGAAT
ACTTATTATTTCGGTATAACGAACGGTTTCTAAGATAAAAATAGAACTGAAAATCGAGAA
GTATTTACATTGCCTTAGCATATTAGTAGAAAGTCAATTGGATTTGATTTAGATGTAGAC
TAAGACATAAATTTCAAGAATACAGAGTTAAAGAAATATAATAGGAGAAAAAGAACTTTC
TTTGAGAAATTATAGTATAAAGTTGCCTTGTTTATGAAATACCTAATGAATCCAACATTC
TCACATTTTAGCTTCTTTTATGAAACTTAGACTTAAGTTGATGCACTATAGAGTCACTTA
TCAAATTTAAAAAATGAGAAAATGAATAATGTTGAGGCTATAGATTATGTTAATAAGGAC
TGGACGGAAGATAATGATGTTTGCATATCAAGAAAATCAACAGAGTTCCCTCGCTTAAAT
TTTAATTACAGCAATCTCTCTCATGAAGATAAACCTTGGGGAAACTAAGGTGATCCATAA
TTAATAGATTTTTATGATCACCCTATATTCACTAAAGATTGCCTAAAACCAGGAATTTGG
TACTATGGAGGTATTCCAAAATCTGATCACTTAGATTTATGTGGATTTCCACCAAAACTA
TCACCTATTAGGACCCTTTTAAATACTGAATATCGCATGGAGATTTGGAGAAACATATTC
ATTAGAGTTAAGATGCTTAAGTTTGATGAATTATGA


>Contig10745.0.g98(protein)
MIERSFNDPDLWNNDHPIILVHGYCGSTMDENWILGGYFHYAFSKTARYLGIDEQTLQPI
YMNNIYEADVSPIGSAFDRACELYQQIIGEERIRQIAQEQDISLAEAVYGKTHVKDHHRN
KFYKIKYLKTQEAESKRMYAFPNGLPGWNNEKIKKIHFVGHSMGAITVRYFQYLLEIGYF
DEIAGKPKSDKSKIVASLTCLSGANNGSLIVNNCGLQYDRELSDWILKKNGRMILAFKMN
VFFQNIYQSQNYQLERIYRKILENDGTHKYELSYQYQNPILYDMNVEMWDWNRKDNESRY
NHLTRLYNEQFQVESKDLSFVDLNPQGLIRLNQFLKTNQNTYYFGITNGFQDKNRTENRE
VFTLPQHISRKSIGFDLDVDQDINFKNTELKKYNRRKRTFFEKLQYKVALFMKYLMNPTF
SHFSFFYETQTQVDALQSHLSNLKNEKMNNVEAIDYVNKDWTEDNDVCISRKSTEFPRLN
FNYSNLSHEDKPWGNQGDPQLIDFYDHPIFTKDCLKPGIWYYGGIPKSDHLDLCGFPPKL
SPIRTLLNTEYRMEIWRNIFIRVKMLKFDEL