Identifiers and Description

Gene Model Identifier

Contig14303.0.g107

Standard Name

SNRPGb

Aliases

Contig14303_0_g107

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008353400.000005000363240844623Sm protein
SGDYFL017W-A 167.4

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14303.0.g107(coding)
ATGGCCAGCAAGTAAGGTTACGGTGCAGACTTGAGAAAGTTCATGGACTTAAGAGTAGAC
TTGAGATTGAATGCAAACCGCCACGTCGCCGGTGTGTTGAAGGGTTACGACTAATTCTTG
AATATTGTGCTTGACAACGCCATTGAAATCATTAACAAGGACGAGAAGAGAGAGCTAGGC
ACCATTGTCATTAGAGGAAATTCAGTGGTCATGTGGGAGAATCTAGACAAGGTTTTGTGA


>Contig14303.0.g107(protein)
MASKQGYGADLRKFMDLRVDLRLNANRHVAGVLKGYDQFLNIVLDNAIEIINKDEKRELG
TIVIRGNSVVMWENLDKVL