Identifiers and Description

Gene Model Identifier

Contig13051.0.g44

Standard Name

SNRPGa

Aliases

Contig13051_0_g44

Description

Alpha/beta hydrolase of unknown function (DUF915)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam06028 ) Alpha/beta hydrolase of unknown function (DUF915)
  • ( pfam05057 ) Putative serine esterase (DUF676)
  • ( pfam12695 ) Alpha/beta hydrolase family

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13051.0.g44(coding)
ATGATAAAAACTAATATATAAGTAGTTGTTTTCTTGTTCAATACCTTCAAAGCGACAAGC
TTCACTCAAACCTTGTTGCCCGTAACAAATTCAAAAATTCGTAACAATTCTAACCTGACC
ATGCTTGCTCTGACACTCTCATTCTGCTACAAAGTTATTCAGAAAGCATATAAATTGCAA
AGAAGAAAAGCATTGTAACAATATGAAGGTTTACCCAAAGATCAATGGAAAAATGACTAT
CCAATCGTGTTAGTGCACGGCTTTGGAGGCTGGGTTCCAGATGAATCTTTTTTCTTTGGA
GACTACTTCGCATATGCAAGTTACCCAGATGTGCAGGGAGATAATAAGATATACCAAGCT
GACATAGCACCATGGGGAAGTTTACACGATAGAGCTTGTGAACTGTACCAGTAGTTAATA
GGAATATTCTAAACACAGCGTAACGCAGATAGAAATCGGATGACGTTAGCAGAGTAAGTT
TATGGAAAAGAACACTTCGACTTAGAGCATAGAGAACAATATTACAAGACTCGTTACCTT
CGCAGGTAGGTTGACGGAAAGACTCTAGCTTATCCAAACGGAATACCTGAAGGTTGGAAT
CGAATTCAAAAGATTCACTTTGTAGGGCACAGCTAAGGAGGCTAGACAGTCCGTTATCTC
TAATACTTACTTAAAATTGATTATTTTAATGATGGTAAAACTCCAAAAACAGACAAGAGT
GATTGGATTGCTTCTTTTACTGGTCTCAACCCAATTTTAAATGGAGGTATAGCAAGTTAT
ATGTTTGACTTAAGTCTGGAAAAAGAGAAGTTTGTGGGTCCTAAAGAGGGAGGTACCCTT
AGAGATAGATGGTTCATTGAAGGCTGCAAGATTTTCACTATTTTACAGAATTTAGTTTAA
AACAAAGCCACTCTTAATGTGAAAAGAGAAAATATTAAGAATATCATTAAACAAGGCTCA
AATGACTAAGAGGTTGTCTACGAACTTGCCAAGCAGCCATATTTCTTCTTTGATTTTAAT
CAGGAGACAATAGGACACAACAGAAGAGAAGGGGAAAAGATAATCGACTACGTAAAAAGA
GTCATGTAAAGTGATGTACTTTACTCCTCAAATGACTATGCTGTTCATGAGTTCTGCCCA
GTCCATATGAAAGATATTAACTCAAGAATCAGCGAAGGTATGTCCTCTTCTACCTATTAC
TTCACCTACGCTGCAGGAATAAGGAACAAGAAAAAAACAAAGCAACGTGAAGTCCTATAA
GAACCAAAGTAGCTTAGTAAAATTGCTATGGGTTTTGATTTAGATATCGACCATCACATG
AAATTTAACGAACATCATGATAAAATACCTAAGAGATTAAGGGAAAGTCCAGGGTTCATT
GAAAGAATCATTACCATGTTTAAAGTACTCTCAAACATTGTTTCTATTAATAACAAGGTG
TTTTATGAAAATTTGACCATTCTGTAATGCCCAGCTAAATACCTTAACAACATCCTAAAT
CCAAATATGAACAACACCTAATCATTTGACTACGCCAATAAAGATTTAACTGATGACAGT
GATATGATCTTACCAAGATGGACTTAAGAATTCCCAAAGTTTGCTTCAAATTATTAAGAT
AAATTTTCTTAAAACAAGCCTTGGGGTTAAAAATCTGAGCCTGTCTATTTTGACAATGAA
ATCGATTCAAGAATCCAATAATCATTTGACAAAGGTGTCTGGTATTACTCTTCTTTACAA
ATGAGTGATCATCACGACTTAGCTGGTTTCCCTAACAAATTCAAGGTCCTCTAAACTATT
TTAGGCAGAGAATTTAGACCATAAGTTTACATAAATATCTTCAACAGACTAAGAACTCTG
GAATATGTTGAATGCACATATCTTAGAAAAAACATTGACTACTTGGAATGA


>Contig13051.0.g44(protein)
MIKTNIQVVVFLFNTFKATSFTQTLLPVTNSKIRNNSNLTMLALTLSFCYKVIQKAYKLQ
RRKALQQYEGLPKDQWKNDYPIVLVHGFGGWVPDESFFFGDYFAYASYPDVQGDNKIYQA
DIAPWGSLHDRACELYQQLIGIFQTQRNADRNRMTLAEQVYGKEHFDLEHREQYYKTRYL
RRQVDGKTLAYPNGIPEGWNRIQKIHFVGHSQGGQTVRYLQYLLKIDYFNDGKTPKTDKS
DWIASFTGLNPILNGGIASYMFDLSLEKEKFVGPKEGGTLRDRWFIEGCKIFTILQNLVQ
NKATLNVKRENIKNIIKQGSNDQEVVYELAKQPYFFFDFNQETIGHNRREGEKIIDYVKR
VMQSDVLYSSNDYAVHEFCPVHMKDINSRISEGMSSSTYYFTYAAGIRNKKKTKQREVLQ
EPKQLSKIAMGFDLDIDHHMKFNEHHDKIPKRLRESPGFIERIITMFKVLSNIVSINNKV
FYENLTILQCPAKYLNNILNPNMNNTQSFDYANKDLTDDSDMILPRWTQEFPKFASNYQD
KFSQNKPWGQKSEPVYFDNEIDSRIQQSFDKGVWYYSSLQMSDHHDLAGFPNKFKVLQTI
LGREFRPQVYINIFNRLRTLEYVECTYLRKNIDYLE