Identifiers and Description

Gene Model Identifier

Contig15293.0.g12

Standard Name

SNRPFb

Aliases

Contig15293_0_g12

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR182W0.000009999254677478949SMX3 SGDID:S000006386, Chr XVI
from 900194-900454, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15293.0.g12(coding)
ATGATAAAGGGCAAGCAAGTAATTGTGAAGCTAAATGACGGCACAATCTATAGGGGTACT
TACATTTGCCTTGATGGAAACTTAAACACAGTTTTGGAGAAATGCGAAGAATTGAATAAA
GATGGGAGAGTACTAGGGAGATATGGAGATATTTTTATCAGAGGCAATAATGTTTGTTAC
ATTGCTCCTTATTAAGCACCATAAGAAAGCGCAAATCATGAAAATTAGGCAAGTGGATAG
ATCGAGACCAATATGGTACAAGTGTAGTGA


>Contig15293.0.g12(protein)
MIKGKQVIVKLNDGTIYRGTYICLDGNLNTVLEKCEELNKDGRVLGRYGDIFIRGNNVCY
IAPYQAPQESANHENQASGQIETNMVQVQ