Identifiers and Description

Gene Model Identifier

Contig19089.0.g58

Standard Name

SNRPE

Aliases

Contig19089_0_g58

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004679599.996273942859018e-26Small nuclear ribonucleoprotei
n E, putative
SGDYOR159C2.0002795641672355e-21SME1 SGDID:S000005685, Chr XV
from 633566-633282, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19089.0.g58(coding)
ATGGAAAAAAATCAACCAAAAAAGCTCCAAAAGCTTATGATCAGACCAATTTTCTTGATC
TACAAATTCTTCCAGACTAAGTCAAGAGTGGAGATTTGGCTCTATGAAAACGCTGATTTG
AGAATCGAGGGAAAGATTATTGGATTCGATGAGTACATGAACACAGTCCTAGACGATGCC
GAGGAAATTTATCAAAAGAAGGGGAACAGAAGAAAGCTAGGCAGAATTATTCTAAAGGGA
GATAACATTTCACTTATTTGCAATATCAGTGAATGA


>Contig19089.0.g58(protein)
MEKNQPKKLQKLMIRPIFLIYKFFQTKSRVEIWLYENADLRIEGKIIGFDEYMNTVLDDA
EEIYQKKGNRRKLGRIILKGDNISLICNISE