Identifiers and Description

Gene Model Identifier

Contig4951.0.g71

Standard Name

SNRPD3a

Aliases

Contig4951_0_g71

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006886009.00276429344018e-18Sm protein
SGDYLR147C2.9992476920535046e-16SMD3 SGDID:S000004137, Chr XII
from 434463-434158, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4951.0.g71(coding)
ATGGAAGCTGAAGACACCATGAACATGCGTCTTGACGATGTTTATGTTACAGGCAAGGAC
GGTCGCCAGTATCATTTGGACTAAGTATTCGTGAGAGGCAGTCAGGTTAGATTCATTATC
ATCCCGGACATGCTTAAAAATTCACCCATGTTCAAGAGAATTGCAAATCAAGCAAAGAAG
GGCAAGAATGCATTACTTGCTAAGGGTAGAGGCAGAGGAATTGGGAATGAATTAATAGCA
GAAGAAGACCATCCAAGATAAAATTTAGAAGCCTCAAAGGATTTTGAAATAGTAAATTTC
ACAAAGAAATTGCAAAAAGTTTCTGAATAAAGGCAGCTATAGCAGAAGTTTCAATCAAGC
AACTCAAGTTCAAAAACAGAAATCAAAGAAAAAGGTGTTAAAAAACATATTTCTTTAACT
TAAAAATTAACTATGGAGTTCGATCAACTCAGAGATGACAAAACTTAAGACAATAATGTT
GTTAAAGTAAAGCAATCATAAAAATAAAATGACTTTGTTTAAGATGAAACTAAATTTGCT
GAAAAGTTACGAAAAGCAAGGGAAAATCAAAAGAAATAACTTAGTCCGAATAAATTTAAA
GAACAGAGCTCTAGTAAGCAGAGGTTAATGACTTTCAATCCTAGAACTAGTCTTATGGAA
AGTTATATGACTTAATAAGATATTAAAACTAGCGAAGAGCAAAAACACAATGAATTGATA
AAAGTAATACAGACCCTTGATAAATACAGTATGAAAGACATTTCCTCAATGATTTAAAAG
CAAGTTATTCAAGAAGAGGTAAAGGTTATACAGTAACACAAAATTAACTTAAAACCCAAA
GAGGACAAAGATGATACATAACTTTCCCAATATGACTCTCTGTACTCTCAAAGATAGCTA
TAAAGTTAAATACAAAGCTTCCTCCCGTTTTAACTTGATAAAGAAAAGCTAGATTTATCA
TCATTTATTGACTTTAAGCTAGTTTAGAACTTAGCTGATCAACCTGTTATTGGAGTGAAT
ATATATGCTAAGCAAAAGCTAAAGAAACTAGATTTATTGAGAGTTTTAGTACATCAATAA
CTAAGTCTAAACAATACTGAACTAAGACTAATGCTTATACAATCCCTCTTACTTCTCTTT
GACATTGAAATTGCGATTACTCTGATTGCAATATTTTTCTATGCCTTTAGCTGCTAGAAA
TACCTTATAGTCTCATTCATCAGTGAATCAATATTGATGATATCTTATGAATATATTGAG
CTAATAACGAAAGATTAGAATGGCATACTTCAAAAACTGTAACTCTATATCAAAGCAGCT
TTGAAATTAATTGATGAAGAGAGAACTAAATATGAAAACCTAAGTGAAGAATTTATTGTC
CTAAAGCATACATCGTAAAAGTTAAGGGAGAATTATAGGTTAATTGTTAAACATTAGAAA
ATTCTGAAAACTGTAGACTATCATTCCATGCTTATTAAGAACTTTCAAGATGGCTTAGAT
GAGAGCAATTTTGCCTAAACTCTTCATTTAATAGATTTAAAGTTCTTGGAAAACCTTTTC
GTGAATAATTTACTGAGAGATGCAGAGCTAAATTACCAGGTAATATTGCAATTACATAAC
GATTTACAATTTATAGGATCAAGTAAAAGTTTATTAATATCTGGAATATCTAAACTTGTT
AACTACAATTTTAAGAAACTATGTGCTTCAGAGTCCAAGTAATGA


>Contig4951.0.g71(protein)
MEAEDTMNMRLDDVYVTGKDGRQYHLDQVFVRGSQVRFIIIPDMLKNSPMFKRIANQAKK
GKNALLAKGRGRGIGNELIAEEDHPRQNLEASKDFEIVNFTKKLQKVSEQRQLQQKFQSS
NSSSKTEIKEKGVKKHISLTQKLTMEFDQLRDDKTQDNNVVKVKQSQKQNDFVQDETKFA
EKLRKARENQKKQLSPNKFKEQSSSKQRLMTFNPRTSLMESYMTQQDIKTSEEQKHNELI
KVIQTLDKYSMKDISSMIQKQVIQEEVKVIQQHKINLKPKEDKDDTQLSQYDSLYSQRQL
QSQIQSFLPFQLDKEKLDLSSFIDFKLVQNLADQPVIGVNIYAKQKLKKLDLLRVLVHQQ
LSLNNTELRLMLIQSLLLLFDIEIAITLIAIFFYAFSCQKYLIVSFISESILMISYEYIE
LITKDQNGILQKLQLYIKAALKLIDEERTKYENLSEEFIVLKHTSQKLRENYRLIVKHQK
ILKTVDYHSMLIKNFQDGLDESNFAQTLHLIDLKFLENLFVNNLLRDAELNYQVILQLHN
DLQFIGSSKSLLISGISKLVNYNFKKLCASESKQ