Identifiers and Description

Gene Model Identifier

Contig21914.0.g48

Standard Name

SNRPD1

Aliases

Contig21914_0_g48

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012890803.001129784945559e-41Sm protein
SGDYGR074W3.9992896861436003e-19SMD1 SGDID:S000003306, Chr VII
from 635712-636152, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21914.0.g48(coding)
ATGAAGTTAGTCCGCTTTCTAATGAAACTCAATAACGAGACAGTCACTATTGAGTTGAAA
AACGGAACCATCGTGGTTGGAACAGTCACTGGTGTTGATGTGTCAATGAATACCCATTTA
AAGGCAGTGAAATTAACAGTGAAAGGAAGAGAAACAATTGCGCTTGATCACTTGACAATC
AGAGGAAATAACATCAGATACTTCTTATTGCCCGAAAGTCTATAACTAGAAACCCTATTG
GTTGATGATGCACCAAAGCTGAGAGCTAGAAGTATTGGACAGGCAGCTAAAAAAGAAAAA
GGCAAAGGCGGAGCAGGAGGTGCTGGAGGAGGAGCATTTAATAGAAAACCAAAGAGACCA
CCTCCCAACCCAACCAGACAGCACTGA


>Contig21914.0.g48(protein)
MKLVRFLMKLNNETVTIELKNGTIVVGTVTGVDVSMNTHLKAVKLTVKGRETIALDHLTI
RGNNIRYFLLPESLQLETLLVDDAPKLRARSIGQAAKKEKGKGGAGGAGGGAFNRKPKRP
PPNPTRQH