Identifiers and Description

Gene Model Identifier

Contig587.1.g71

Standard Name

SNRPD

Aliases

Contig587_1_g71

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_014038102.000364041471746e-45Sm protein
SGDYLR275W3.998693556225637e-29SMD2 SGDID:S000004265, Chr XII
from 694378-694382,69447...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig587.1.g71(coding)
ATGGCAGACGAGAAAAAGCACATCCCCTAAGAGGACACTTTCCACGAAGGTCCTCTCTCC
CTCCTAACCAAAGCAGTTAAGACAAATTCCCAGGTTTTAGTTAATTGCCGTAACAACCGC
AAGCTCCTTGGAAGAGTGAAGGCTTTCGATAGACACATGAACATGGTGCTTGAGAATGTC
TGCGAGATGTGGACGGAAACCCCAAAACCTCACAAGGGAAAGAAGGCTCACCCAGTCAAT
AGAGAAAGATACATCTCAAAGATGTTCTTGAGAGGCGATTCAGTCATTATTGTCATTAGA
AACCCTAAGTGA


>Contig587.1.g71(protein)
MADEKKHIPQEDTFHEGPLSLLTKAVKTNSQVLVNCRNNRKLLGRVKAFDRHMNMVLENV
CEMWTETPKPHKGKKAHPVNRERYISKMFLRGDSVIIVIRNPK