Identifiers and Description

Gene Model Identifier

Contig22266.0.g10

Standard Name

SNRPC

Aliases

Contig22266_0_g10

Description

U1 zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004185605.997612587164444e-16U1 zinc finger family protein
SGDYLR298C0.0000899730839127287YHC1 SGDID:S000004289, Chr XII
from 725416-724721, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22266.0.g10(coding)
ATGCCCAATTTTTATTGCGAGTACTGTGGAATCTTCTTGAAGCATTCTTCTCCATTCGGT
CGTAAACAACATTCCAGAGGAAAAAAGCATTAGTTCAATAAAATTGAATACTACTCTCAG
TTTTTGATTGAGTTCCAGCAACAGGCCTAATAGCAAATGCAGCAGAAATAAATGCAGATG
CCTCCTGGTCCTGGAGGTCCTCCACCAGGCGCTATGATTAGAGGTCCTCCTCCAGGAATG
CGTCCACCTCCACATATGATGGGAGGTCCAGGTGGCCCTCCACCTAGAATGATGCCTCCT
CCAGGAATGGGAGGAATGCCTCCTCATGGTGGACCGGGAATGTACCCCCCTAGAATGATG
GGACCACCACCAGGCATGGGAGGTCCAGGTGGCATGCCTAGAATTAGACATGGTTGA


>Contig22266.0.g10(protein)
MPNFYCEYCGIFLKHSSPFGRKQHSRGKKHQFNKIEYYSQFLIEFQQQAQQQMQQKQMQM
PPGPGGPPPGAMIRGPPPGMRPPPHMMGGPGGPPPRMMPPPGMGGMPPHGGPGMYPPRMM
GPPPGMGGPGGMPRIRHG