Identifiers and Description

Gene Model Identifier

Contig12619.0.g67

Standard Name

SNRPB2

Aliases

Contig12619_0_g67

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008425001.999683289470905e-41U1 small nuclear ribonucleopro
tein A
SGDYIR009W0.0000000000000299873730555305MSL1 SGDID:S000001448, Chr IX
from 374525-374860, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12619.0.g67(coding)
ATGTCAGAAACTCCGTAGTAAGATGTGCCTCCTTAATAATTCAGATAGCCTCCTCCACCA
GGGATGGGTATGCCACCTCCACCCATGAATTATCCACCAGGTCCTCATTAAATTATCAGA
CCACCAATGCCCATGAACCTGCCCCCTTAACAACCATCAATGATGCAGAAAATCATGGAA
GAACCTTTGAACCCTCCTAACCCCACTCTATACGTTTAAAACCTCAACGAAAGAGTAAAG
GCAGCTGACCTCAAAAACGCTCTCTATCAGTTATTCTCAAATTATGGCGAGGTCATTGAG
GTTCATGCCAAGAAAAACATCAAAATGCGTGGTTAAGCATTCGTAGTTTGCTAGGATGAG
GAAGCCGCTGATAGTGCCATACAAGCTTTAAGAGGCTATATGTTCTTCGGAAAGCCCTTG
AGACTTAATTATGCAAAGACTAGAAGCGATGTGACTGCTAAAATGAGAGGCACATTTGAT
GAGGAAGTTAAGGCGAAGAGAGAGTTGAGACGCCAACATGAACTGAAACAGAGACAGTTA
AAGCAAAAGAGAAAGATTATAGATAAATTCCTCAAGCTTCGCTCAGACAATGAAGAAATG
TAAAACTTGAGAGGTGGCCCTTCAATTTAGAAAATTGCTGGATTTTCTGTAAATGGATAG
GAGTCAAACAATTTGCTTTTCATCGAGGGACTATCAAAGAGAACCCCCACATCAATCTTG
AATGAAATCTTTTCATAAGCAGTCATTGGAGGGTTTAAGGAAGTTAGACATATTGCAGAG
AAAGAAGTGGCGTTCGTAGAGTACGAGGATGATCATGTAGCTTCCATCGCCATGAATGCA
TTATAGGGTTACTAGATCAAGGAAAGCAACGGAGAGACTACAGTGCTCAGCATTAGTTTC
GCTAAGAGATGA


>Contig12619.0.g67(protein)
MSETPQQDVPPQQFRQPPPPGMGMPPPPMNYPPGPHQIIRPPMPMNLPPQQPSMMQKIME
EPLNPPNPTLYVQNLNERVKAADLKNALYQLFSNYGEVIEVHAKKNIKMRGQAFVVCQDE
EAADSAIQALRGYMFFGKPLRLNYAKTRSDVTAKMRGTFDEEVKAKRELRRQHELKQRQL
KQKRKIIDKFLKLRSDNEEMQNLRGGPSIQKIAGFSVNGQESNNLLFIEGLSKRTPTSIL
NEIFSQAVIGGFKEVRHIAEKEVAFVEYEDDHVASIAMNALQGYQIKESNGETTVLSISF
AKR