Identifiers and Description

Gene Model Identifier

Contig9185.0.g60

Standard Name

SNRPA1

Aliases

Contig9185_0_g60

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005022509.999142814001536e-47Leucine Rich Repeat family pro
tein
SGDYPL213W1.000361553249356e-16LEA1 SGDID:S000006134, Chr XVI
from 150614-151330, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9185.0.g60(coding)
ATGAGAATAAACACCGACCTTATTCAGAAATGTGCTCAGTACTTGAACGCACTAAATGAA
TTTCACATTGACTTGCGTGGTTATAAAATTCCCTTCATTGAGAACCTAGCAGCTACTAAC
GACCAATTCTCATCAATCGACCTCACAGACAATGAGATTTCAAGATTAGAGAATTTACCA
CAATTATTGAGACTTTCGACTCTGCTGCTTTCAAATAATCGCATTGCCAAAGTTGATCCT
ATTTTTGCAGAAATGTGCCCAAAACTAGAATCTCTGATCTTAACCAACAATAAAATCTCA
AATTTACAAGAAATTGACAACATAGCACAAGGTTGCAAAAATTGCACACTCCTAAGATTG
AGTCTTGTTGGGAATATCGTAACCAACCTTCCAAACTATAGAGCTTATGTAATTCATAAG
ATTCCCTCTCTTAGAATCCTTGATTTCCAAAAAGTCACTTAAAATGAGAGAAAGGAAGCC
AAGAAGCTGTTTGAGGGACAGTAAGCTATGAAAGAGATGCTTGTGAGACAATAAGAAATT
GATGAAAACCTCAGAAGAGACACCAAACAAGGAACACTTGGCAAGAGAATTATTAGTGAA
GAGCAATTAGCAATAAATTTGAAAATTCAAGAGTTGGAGCATTAGATTGATCAAGCACAT
AGCTTGGATGAGATACAAAATTTAGAGAGATAAATCAAAGAACTCAGTGATTAAAACCAA
GGTACAGAAGATAATTGA


>Contig9185.0.g60(protein)
MRINTDLIQKCAQYLNALNEFHIDLRGYKIPFIENLAATNDQFSSIDLTDNEISRLENLP
QLLRLSTLLLSNNRIAKVDPIFAEMCPKLESLILTNNKISNLQEIDNIAQGCKNCTLLRL
SLVGNIVTNLPNYRAYVIHKIPSLRILDFQKVTQNERKEAKKLFEGQQAMKEMLVRQQEI
DENLRRDTKQGTLGKRIISEEQLAINLKIQELEHQIDQAHSLDEIQNLERQIKELSDQNQ
GTEDN