Identifiers and Description

Gene Model Identifier

Contig4094.0.g73

Standard Name

SNRNP70b

Aliases

Contig4094_0_g73

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam05172 ) Nup53/35/40-type RNA recognition motif

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005942100.0000000006999585478469937U1 small nuclear ribonucleopro
tein 70 kDa
SGDYNL110C0.00000009004106436083642NOP15 SGDID:S000005054, Chr XI
V from 418488-417826, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4094.0.g73(coding)
ATGAGGGATTTGGAAAATAAGTTCTTTTCTGAAACTATTGAACCTTATGATCCCATAAAA
GTAGGGTTTAAAGATGGGAGAGGAAAATAATGTCATGATAACGCCCTTTATAGAGCTTCC
AAAGCAAGTTATGAATCGCTATTTGATTCACAATAAAACAAGAATAAGATATTTGTATCT
AACTTCGTACCTCGAACTTCTGAGAGAGATTTAGTAAATCATTTCTCTAAGCATGGAGAA
ATCAAGGAAATTTAGATAATCAGGGATAAAGTAACTGGGTGTTCGAGGGGGTATTCATTT
ATTGAGTTTTACAAAAGAGACGATGCTTTTTAAGCTTATTGCTAGGCTAATAAGACTACG
ATGGATAATGGAAGTAGAGATATCAATGTAGATATAGTTAGGAGTGGAGGCAAGCAAGAA
GGGTTTGTACCAAGACGTCTGGGAGGGGGTTATGGGGGCAAAGTCAAAGGAAGTTAAATC
AGGTTTGGTGGGAGAGATAAGCCCTTCTTTTGA


>Contig4094.0.g73(protein)
MRDLENKFFSETIEPYDPIKVGFKDGRGKQCHDNALYRASKASYESLFDSQQNKNKIFVS
NFVPRTSERDLVNHFSKHGEIKEIQIIRDKVTGCSRGYSFIEFYKRDDAFQAYCQANKTT
MDNGSRDINVDIVRSGGKQEGFVPRRLGGGYGGKVKGSQIRFGGRDKPFF