Identifiers and Description

Gene Model Identifier

Contig15498.0.g41

Standard Name

SNRNP70a

Aliases

Contig15498_0_g41

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam12220 ) U1 small nuclear ribonucleoprotein of 70kDa MW N terminal
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005942107.003307964816097e-28U1 small nuclear ribonucleopro
tein 70 kDa
SGDYIL061C6.002144168983342e-19SNP1 SGDID:S000001323, Chr IX
from 245559-244657, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15498.0.g41(coding)
ATGAGTAGAACTTTATTGCTCCAACCTTCAACTCTGGGTTTTGTGGCTAATCAAGACATG
CCACATCATTTGAGTATCCTCTTCAGAGCAAGACCACCTCTAGAATATCAGAAACCAATT
GAAAAAGGTAGATGCAAACCACTTCGCAGCTACTTTGATGGAGTGCGTGATTACTTTGCT
ATGTTTGAGGATGTGAATGAAACTGAGAAGCCACAGCAGAAGCAGGAAGTTGAAAAATCT
GATGTAAAGAAAGAGAGAATAAAGAAGGAGAAGATTATTGATCACTTAGTTCATCAGTAA
GAGGATCTTAAATAATGGAATCCTTACAAAGATCAGAAAATCAAAGGAGACCCCTTCAAG
ACCATCGTAGTTTCTAGATTGTCTTACAAAACAGATGAGAAAACTCTCAAGAAAGAGTTT
GAGGTTTATGGGCCAATTAAGAGAGTGAGAATTATTATTGATCAGCATAGTGGAAAACCC
AAGGGTTATGCCTTCATCGAGTATGACAATGAGAGAGACTTCTAATTGGCTTTGGAGAGA
GGCAATGGAAGAAGAGTAGATGGCGCAAGAGTAGTGGTTGATTATGAAAGAGGCAGAACT
AAGACTGATTGGATTCCAAGGAGATTGGGAGGAGGCAAAGGCGGTGATAAACGCAGAGAC
CGTGAGACAGAGAGAATGATCAGAGACTTGAAGAAATCTCACCCCAAACTCAGAAGTAGA
TCCAGAAGTCAGGATAAGAAGGACAAAAATATTGATGCCAACTCTAAACCACCTGACCAA
TCTAATGGCACTCAGCAACCGACTGAGGAGAAGAAAGAATCAAGAAAAGAAACAGTTAAT
GACGCCTAACCAGCCAGAAAGCACAGATCTCGATCACCCAGGGATAAGTCCTTGAGAGAC
AGTCACCGTGACAATAGAGACCACAGAGACAATCACCACAGATCAGATAAGCGCAGAGAC
TAGGATGATCACATCTCACCAGCTAAAAACGACAGAGATAGATCAGAGAGAGATAGGTCT
GAGAGAGACCGTGGTAGAGATGACGACAAGAAGAGAGGTGACAAGAAGAGCAAGAAGGAT
AAGAAAGACAAAAAGGACAAGAAAGACAAGAAGGAGAGGAGAAAGTCCACTGAAAATAGA
AAACCTGATTAAAAAGATGCAGTCGCAAAGTCTGATTAGGATGAAGTTAATAATAATGGA
CATCAAATTACTGCTAATGGGAGTGATCCTATTGCTACTGTTAATGGTGATTAAGTTGTT
GAGGAGGGCGAGATTGAATGA


>Contig15498.0.g41(protein)
MSRTLLLQPSTLGFVANQDMPHHLSILFRARPPLEYQKPIEKGRCKPLRSYFDGVRDYFA
MFEDVNETEKPQQKQEVEKSDVKKERIKKEKIIDHLVHQQEDLKQWNPYKDQKIKGDPFK
TIVVSRLSYKTDEKTLKKEFEVYGPIKRVRIIIDQHSGKPKGYAFIEYDNERDFQLALER
GNGRRVDGARVVVDYERGRTKTDWIPRRLGGGKGGDKRRDRETERMIRDLKKSHPKLRSR
SRSQDKKDKNIDANSKPPDQSNGTQQPTEEKKESRKETVNDAQPARKHRSRSPRDKSLRD
SHRDNRDHRDNHHRSDKRRDQDDHISPAKNDRDRSERDRSERDRGRDDDKKRGDKKSKKD
KKDKKDKKDKKERRKSTENRKPDQKDAVAKSDQDEVNNNGHQITANGSDPIATVNGDQVV
EEGEIE