Identifiers and Description

Gene Model Identifier

Contig11029.0.1.g31

Standard Name

SNF3a

Aliases

Contig11029_0_1_g31

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005855202.000214949834694e-50Helicase conserved C-terminal
domain containi...
SGDYBR245C0.000000000000001999258566166494ISW1 SGDID:S000000449, Chr II
from 711539-708150, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11029.0.1.g31(coding)
ATGGCGGAGCCTCCTTGGAATAAAAGCGGTGGTGGAGGAGGCTATGGCATGTCTCAAAAT
TGCAATGAAGGCAGCAAATTCGGAAATAACAATGGCTTCAACAACAACGGAGGAGGAGGT
GGTTATTAGAATAATGGAGGTAAGCCTCCATTTTAAAAGTTTAACAATGGAGGCGGCTAT
AAACCTAATAATAGCTACGGTGGAGGAAATAAATGGAACAACAACAACAACTCTGGCGGA
GGATACTAGAATAACAACAACAATCAAGATGGAGGAAATAATTAAAATGCTGGTGGAGGC
TACAAACCAAACTTCTAAGGTGGAAACTAAAACAACAATACTGAATCTGCTGGAAATAAC
GATGGCTTCAGCTCTGGATAAGGAGGAGCTCAGAAAAGTAACTTCTAAAACAATAATAAT
AACTACAGAGGAGGCTACAATAATAACAATAATCAGCAGCAAAATCAATATGGCAATAAT
AATAATGGAAACGATTAATAGTAATAGTAAAATCTAAACCCATACAACGATATGTCCTCT
AAAATTGTCTTAGAACTAATTTCTCATGACTATTTCTCAATTAAGTTTCAGAAATTTTTC
AATTAAGACTGTAGCGAAATGGTTAAATAGCTGAAATAGAAAGGAAAAGATATAATTAAT
TGGGATGTTCAAAGAAAGTAATGGAACGTTCGGATTGATGAGTATAATGATTTACTATAG
TAATTTACAGATTATCTAGCTAATAACCCTTAGAAATCACAAGTTGATATTAAAGGAATC
CCAAATTTTGCTTTCGAACTGCTTAATGGAAAACCACTTTTGACTCAAGACGATCAAAGG
CAAGATAATAGAACTTACTCAATGGGAAACTTACCGCCTAGCATGAGAGACAACTTATTT
GAGTATCAAAAGAATAGTGTGATTTTAGGAGTCAAATAATAAGGTAGATTCATGATATTA
GATGAGATGGGCCTTGGTAAAACATTAGAATCATTAGCAGTAGCTATGGTATATTTTGAT
GAATGGCCTTTGCTTGTTGTTTGTCCAAGTCAAATGAAAAATCACTGGAGAGAAGAGATA
CTTAAATGGATACCAGATTTCGATCCTTCACAAATTACTGTAATGAGAAAAGGCAGGGAA
GCTTTCAACGATAACTCAAAAGTCTTTATTACATCTTATAAAATTGCTGCTAGATAATAA
TCTCAAATCTAGAAACGCTTCTAAAGTCCGGTCAGTAGAATATTGTGTCCGATCCTGTCT
AAAATGAAAAGACTAGTTTTAACTTCAAGTGCACCTCTTATGGAAAAACCTCAACATCTC
TACAATTTATTTAACATGATTAGACCAGATATATTCTAAGACTAAATGGAGTTCATCTCA
AGATACTGCTTTTCAAGAGACGGTCAAATACTGGGTCCTTAAAATTAAAGAGAGATGCAC
TTCATTTTAGACAACAAAATTATCTCAACCAGGAAAAAGAAAGATGTTGCTCATGATATG
CCTCCAATTTTGAAGTAAAAGCTTCATATTAAGTGTGACCTCAATGAAATGCAAGAAATT
AGGGTAATCTTAAATGGTCGAATGCTCAGTGAAAGTATGTAAACTCTATTTGTTTAATTA
AAAAATATAGAAAAAGAAGCGCAAAGAATCACTGAAATAATCAAATGTAAAATGGATCGA
ATGTCTACTTCAGCGAATAATTACAACGATGTAGGAAATTTACTAGGAAGTAACTAAAAA
GATGACTAATTGATAGACTAGCTATTTGAAGTTTCATCTCAAGCTAGAATAAAAGGCATA
CTTAAAACTGTTTCTTAGATCCTTGAAAATGAGTAGAAGGTCATAGTCATAGCTCAGCAA
AACTAGAGCATAGAAGAAATTGAAAATACTGTGAGAAAAGTATTTGACGATCAGAGAGAA
AAGAATGAGTCTAACTACAATTACATAAGAATAGACAATAACACTCCCTCAGATTTGAAA
TAACAAATGATTCGAAATTTTTAAGAAAACCCAATTATCAAAGTTGTAATATTGAGTTTG
GCAACATCGTCTTTGGCATCAGTTTTAACCTCTGCTTCTAACATAATATTTGCTGAAACC
TATTGGAATAATGAATAAATGGCTTAAGCAATTTTCAGAGATGCTCGAAGTTTAAACTAA
GACCAATAGTGCTTGAACGTTTACTATCTATATGCAAAAGATTCTCTGGATGAAATCATT
TTTTAAATAATGTTTCCAGATCTTGTTGACTTCTATATCGGAAACTTCAGTTAAAGCTAA
AATACTCGTCAGATTCCAGACTAAAGTAATCAGTAGCTGTATAAAAAGTCAAATGATTAG
TTTAACAAACGAGACTTAAAATACAATGGTAAACAGATGAACTAAAACTAAGATCATGAA
GAAGAGCACATGAGCCAAATTAGTGACCTTGATATGCTTTAGTAGTGTATTTAAGAGGAA
AGTCATAAGTCTGGCGGAGGAAACAAAAAAGGAGGACTTGATAACTTCCGCTATGGTGAT
CAGCCAAACAGCTAATCTCAAGGATAGAGAAACATTAAACTTACTGGTCAATCAAAAAGG
ATTTTAAACAGCAGCGAAGATCATGAGGAATCAATTGAGAGAGACTCTAGTCCCGATAAA
TAGCGCAACTATAACATGATGAATAGAAGTCTTTCTTAAAATGGATACTATCAAAATGGA
AAGTACTAAAATGGCTAAGATTAGAATAACTATTAACAAAGGTTTAACTAAGACAGCAAC
CAGAATGATTACCAGGTAGATTCAAATTAGATGAGAAATATCTTAGATGATGGTCAACCT
CTATCTCAAAAAATGGATTAAGAGGGAAATTATTAATAGACTTGCTCAGCAAGTACCGCA
GATTAGAAAAACAATTTGTCTTCATCTTAGCCAAAAACAGGTGATGAACCAGCAAGAGTA
GAAGGATTCTTCGGAAATTAAAACTAAAAAGATAGCAAAAAAGATCCAAATTAAAAATCG
AAAGAATTCAAGCCTCAATTTAAGTAAGTGAGCTCTTAGAAGAAATCTCAACCTGGGTAA
GCTAGCAACAACAAATATGATAGTATTGAGGACTTTAGTTGTGAAAAGTTTATAGATAAG
TATTAAGCAAATATGAGAAAAAATAGCCAAAAGGCAAATGTAGTTTCAGAGAGACCTTCA
CTTAATAATGAAAATTTGCACCCTCTACAGGCTCATTACTAGCAATATTTACAGTAGTAC
AATAACAATTTCTATTCATCCGCAGATTTAAGTTTATCATAAAGTGAAGTAAGTGATGTG
AATTATACCTAGAAAATGATTGATAGTTAGAGATCCTCAAGACTCAATATGTCTAAGAAG
TCGCTTCCAGCTAATAACTATCAAAATAACCAATCTTAAAATGTAGCTGCAAGTAACAGT
GCTTCAAGTAAGGGTACTCCATCTTTCTAGCATGGTTAAAGAGTAAAGAAAGGTCTGACG
AATTTACCAAGTAATAATGCAAACAAGCAAAGTTAAATTCAAAATAAAAACTCTAATTAG
CAACAAATGCAATATTTGAATACCAATACTCAAAGCAAGAAGCAGCAGACATCTTAGAGG
AAACCATAAAACACTCCAATGGTTGTAGAGTTTCAAATAAGCAATAAGTTCTCTGATAGC
TAAAATATTTCCCAAAGCAATACCTCAAATAATAACACACAGACCCACAAATCAATGAAG
GCTAATCATAAGAAAAACTAACCATCGATAACCAGTAACACAAGCAGTGCTTAAATGAAT
TAGCATTTCCAGTAGACAACTAAACACTTGAGGTTTGACTCTGTTCAGGACAGTTCAACT
GTGACTAATTAATAATTAATGTCTATTACTAGCTAGCATTACCAAGGTTTGATAAGTGGC
TCATCTTCTGAGATTAATGATCAAGATAGATTTGATGATGATAATCTTAATGGGGATATG
CGGGAATTCAGAGAAGTCATAATGACGGAATCTCCTTAACAACAGAAAAATTAGATCACT
CTCAGTAATTCTTTGCTCGAATGTGTAGATCAATATGGCAACAACATTGATCAGTATTCA
GTGTTAATGGGGGAATCTGAAAACGGAAGGGGAGATTCATCAAGCAAGAAGCAGCTCATG
TCGGAGTTGAACAATCCAAATAGTTACTTAAACTCTATTACAAAGGATCTAAGAGCTTAT
GGTTCTATACACCAAGAAGACACTTAAAATGTTTATAACGTTCAGCTTGCAAATACAGGA
GGCAACCAGAATTTCATAGTATGCTCTCCAAGCGTCAATACTGATGACGACTGCTAGTAC
ACAAACTCAAGTGCAGTTAGAAGCATAATTTCAAATTCTGGCATGAAAAATTAATACAGC
AACTACAACAAGAGAACTGCTTAGCTCATTTACACAGATGAGAGGAAGGAAGAAAATCTG
TCTAGTAACTAAATCGACGAAATGGAGAACACGAATAATGGTTAGTTTAGTAGTGACGAT
AAGGATCAATTCACAGGAGACAAGGGTGATGAGGATGAAGAGATAGAGTCAAAACTTCAG
ATGATTACCGGAAGTTCATAAATTTATAAATCTAAAGACTATCAGGATAAAGGATCTTCA
TTTTAGCCTGACACAAGCAGTCAGAGATAAACTAAATTTGAATATGTGCAGTAGACACCC
ACTCCAGCTTCGTAGTAAAATCAACAGTACTTTTAAATCTTAGATTCTGACTCGAGGAAT
AAAATGATTAATGACACTCCATAAGTTATGTAGATGATTGATTAGTCAAATAATGCTTCA
TCCACCAGATAGAAGAAGTCAAATTATAATAGCTAAAGAAGCAAACATGCCAATATTGGT
GAGCAGCTTTCTCCTGAGGTACTTGGCTCTAGAGAAAATAGACGTAGAAATTAAAGAAAG
GAAAATCAAGACTAAAATAAGAAGGAAAGTCAAACAAGGAATAGTTCCAGATATTTAAAT
TTCAAGGATATTTCACCGCTAGTGAAAAGCTGCAATACGTTTACTTTTGAAAACACTCTC
CCAAATTAATCCACTCTTGAAGTAAACATGATGGGAAAAATATCACCGCCCTTCATGTAA
AACCATTACCCAAGTGTGATTTAAAGAGACAATTTTGGCTTCAATAATACAATGCATAGT
CTCCAAAACAGCAAATTATTCCTAGATACTATAAAACATGCAAACTAGTTAAATTAGCAT
AACTATCAAACAACTCAAGGAACATTAGTAAATTTTAGAGATTAAGAATTGCGAAGCCCC
AATTAAGAATTTTAGCTGACTGGAAAGCTTAGCAGTGTTTTGGAAAGTCCACCTCCGTTA
ACTGAAACATCTCCAGAAAAAGGAATAAAAGATTTCAGTCGCTAATATTTGAATCATGGA
ATGTGGCCTTCAAAGGGAGGACACCATGGTTATAATGATATGATGATTTCTAGAATTTAA
GATGCAAGCATGCTAAGTAGCAACAGAGGCATTAACAACTCAATGAAAATTGGAGATTAA
ATCAAGAGACTTGAGAATCAAATGTCATCAGTATCGAAGAAAATCTATGTAAGTTAATAG
AATAATAACTTAAACAATCCACTTTACTCTTCAGCCGATATGTTCACTTAAGCCTAAACA
AACGGCACTTTCCAAAATCCACTTTAAAGCTAAAGCATTAATCAAGCGCAAGTAAATAGT
TTATACCCGAATATCGATTAAAGCATTGTCTAGAAAATTAACACAACTTTGGACAATATG
AACAACTAATTCTACTTTAAGAGACCTTCTGATCATATTGGTATTGGTAACTCATCTATA
AATCAACTTAGAACATCAAGAGATAACAGCAAAGCCAACATTTCTGGTACTAATTTATTG
AACAATATTTATCATCCCTATCAAATCGGATCTAATTAGCACAGAACCATGGCTAACAAC
ACTGTATTTAACTAATCAAGCTTCGATGACATTTGCAATATACATGGTGGAACTGCAGAC
CAATAGAGCAATATTACTCAGATACATAACAATGACCCCTATGGAGCTCCTTTAACTTCA
CGTTCCAATAACAATCCCTTGAATCAGAGTAAAGTACTGCCTTAAAACATGAGTACCATA
ACCTATTTAAACAACAACCAAAATAACATGAGTTAGAGACACTTAAACAAGTCAAGTGAC
TATTAAGCGCAAAATAGATTTAGCAACGTCAGTGATCCAGTCAGAAAAGTAACTTTGAAT
GGGTTCGGTCTTGGAAATATCAATTAGAAGATGTAGGTAGGTGATGCCTACAATACTGTA
GATAATGAGAATGGGGTAAATCATAACCACCACAACTAATCATCTTCAGGCTTGTGTTGT
AAAGAATGCATCTTTGAAAAAGAAAAGCGTAAAGTCACTCAGAGCGCATTCGAAAGAGCT
CTTGGCATTTCACTTTTCTTAATGGAAGAAATCGACAAGATTAATGTAAAATCTACTGAG
AGACATAGACCAAGCAATATCAGTGTTGCAACCTCTAACAACAATCAACTGTAAATTAGC
AGATAGGAAATTATGAACCTAATGAATCAAACCCAGCACATTAATCTAAAAGGTCAAGGT
GGAATGATGTCGTCGCCAGGGACTGCAAGTTTGAATGGAGGAGTAACAACTCATCATAAT
AGTCAGACAAGACTCTCAAGAAGTAAGTCGCAATCAATGATGCCAGTAGAGTTTGCCAAT
TTGCAGAGAAGTCTACAAATTCCTCGAGGAGGCTTTACTGGAGCTTTTCCCGGTATTTTA
AACAATCTCACACCAAATCTCAGTTATATTTGA


>Contig11029.0.1.g31(protein)
MAEPPWNKSGGGGGYGMSQNCNEGSKFGNNNGFNNNGGGGGYQNNGGKPPFQKFNNGGGY
KPNNSYGGGNKWNNNNNSGGGYQNNNNNQDGGNNQNAGGGYKPNFQGGNQNNNTESAGNN
DGFSSGQGGAQKSNFQNNNNNYRGGYNNNNNQQQNQYGNNNNGNDQQQQQNLNPYNDMSS
KIVLELISHDYFSIKFQKFFNQDCSEMVKQLKQKGKDIINWDVQRKQWNVRIDEYNDLLQ
QFTDYLANNPQKSQVDIKGIPNFAFELLNGKPLLTQDDQRQDNRTYSMGNLPPSMRDNLF
EYQKNSVILGVKQQGRFMILDEMGLGKTLESLAVAMVYFDEWPLLVVCPSQMKNHWREEI
LKWIPDFDPSQITVMRKGREAFNDNSKVFITSYKIAARQQSQIQKRFQSPVSRILCPILS
KMKRLVLTSSAPLMEKPQHLYNLFNMIRPDIFQDQMEFISRYCFSRDGQILGPQNQREMH
FILDNKIISTRKKKDVAHDMPPILKQKLHIKCDLNEMQEIRVILNGRMLSESMQTLFVQL
KNIEKEAQRITEIIKCKMDRMSTSANNYNDVGNLLGSNQKDDQLIDQLFEVSSQARIKGI
LKTVSQILENEQKVIVIAQQNQSIEEIENTVRKVFDDQREKNESNYNYIRIDNNTPSDLK
QQMIRNFQENPIIKVVILSLATSSLASVLTSASNIIFAETYWNNEQMAQAIFRDARSLNQ
DQQCLNVYYLYAKDSLDEIIFQIMFPDLVDFYIGNFSQSQNTRQIPDQSNQQLYKKSNDQ
FNKRDLKYNGKQMNQNQDHEEEHMSQISDLDMLQQCIQEESHKSGGGNKKGGLDNFRYGD
QPNSQSQGQRNIKLTGQSKRILNSSEDHEESIERDSSPDKQRNYNMMNRSLSQNGYYQNG
KYQNGQDQNNYQQRFNQDSNQNDYQVDSNQMRNILDDGQPLSQKMDQEGNYQQTCSASTA
DQKNNLSSSQPKTGDEPARVEGFFGNQNQKDSKKDPNQKSKEFKPQFKQVSSQKKSQPGQ
ASNNKYDSIEDFSCEKFIDKYQANMRKNSQKANVVSERPSLNNENLHPLQAHYQQYLQQY
NNNFYSSADLSLSQSEVSDVNYTQKMIDSQRSSRLNMSKKSLPANNYQNNQSQNVAASNS
ASSKGTPSFQHGQRVKKGLTNLPSNNANKQSQIQNKNSNQQQMQYLNTNTQSKKQQTSQR
KPQNTPMVVEFQISNKFSDSQNISQSNTSNNNTQTHKSMKANHKKNQPSITSNTSSAQMN
QHFQQTTKHLRFDSVQDSSTVTNQQLMSITSQHYQGLISGSSSEINDQDRFDDDNLNGDM
REFREVIMTESPQQQKNQITLSNSLLECVDQYGNNIDQYSVLMGESENGRGDSSSKKQLM
SELNNPNSYLNSITKDLRAYGSIHQEDTQNVYNVQLANTGGNQNFIVCSPSVNTDDDCQY
TNSSAVRSIISNSGMKNQYSNYNKRTAQLIYTDERKEENLSSNQIDEMENTNNGQFSSDD
KDQFTGDKGDEDEEIESKLQMITGSSQIYKSKDYQDKGSSFQPDTSSQRQTKFEYVQQTP
TPASQQNQQYFQILDSDSRNKMINDTPQVMQMIDQSNNASSTRQKKSNYNSQRSKHANIG
EQLSPEVLGSRENRRRNQRKENQDQNKKESQTRNSSRYLNFKDISPLVKSCNTFTFENTL
PNQSTLEVNMMGKISPPFMQNHYPSVIQRDNFGFNNTMHSLQNSKLFLDTIKHANQLNQH
NYQTTQGTLVNFRDQELRSPNQEFQLTGKLSSVLESPPPLTETSPEKGIKDFSRQYLNHG
MWPSKGGHHGYNDMMISRIQDASMLSSNRGINNSMKIGDQIKRLENQMSSVSKKIYVSQQ
NNNLNNPLYSSADMFTQAQTNGTFQNPLQSQSINQAQVNSLYPNIDQSIVQKINTTLDNM
NNQFYFKRPSDHIGIGNSSINQLRTSRDNSKANISGTNLLNNIYHPYQIGSNQHRTMANN
TVFNQSSFDDICNIHGGTADQQSNITQIHNNDPYGAPLTSRSNNNPLNQSKVLPQNMSTI
TYLNNNQNNMSQRHLNKSSDYQAQNRFSNVSDPVRKVTLNGFGLGNINQKMQVGDAYNTV
DNENGVNHNHHNQSSSGLCCKECIFEKEKRKVTQSAFERALGISLFLMEEIDKINVKSTE
RHRPSNISVATSNNNQLQISRQEIMNLMNQTQHINLKGQGGMMSSPGTASLNGGVTTHHN
SQTRLSRSKSQSMMPVEFANLQRSLQIPRGGFTGAFPGILNNLTPNLSYI