Identifiers and Description

Gene Model Identifier

Contig83.0.g2

Standard Name

SNF2

Aliases

Contig83_0_g2

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006271501.9992362000979228e-56SNF2 family N-terminal domain
containing protein
SGDYPL082C0.0000000000000299873730555305MOT1 SGDID:S000006003, Chr XVI
from 404083-398480, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig83.0.g2(coding)
ATGTCAGATTGTGAAATTAATTTTATGGACAATGATTCAGGAAATGATTCTGATGGGCCC
AGAAGACCAGCTTTTGGAAAAGTTATGAGTAAAGGAAAAGGAAATCATAAATTCATTAAA
TATAAGAGTAAGAATGCACCAAGTCTTAATAAAGCTTAGCAAAAATTTAAACTAAAAGAT
GCAAAAAAGAAGCAACAAAATCTAAAGAATATTTTCGGAGGAACTTGTGATAATGAAGAT
TTAAGAGAAGAAAAAAGTACAAAGGTGTTTGAAGAGGCTAATTAGAATGAGGACTGTGAC
TAATTTGAAAAAGAGCTAATGTCAAGTAAGTATTCATTCAAGGGGAAGAAAGGTTTTGGT
TATTAAAAATTTGGAGGAAAACGTGGACCCTACCAGCGCAAAATAAAAATGAATCCAGAA
GATATCCCCGAAGAATTTAAAAGCCGTAGAAATCTATAAAACGCCTCAGACGATGAAGTG
GATGATATGAGTGAATTTAAGTTTAAGAAACCGAAGTACAACAACTTCAAGAAAAAGATT
GTAGACAATTCTGAGTCTTAACAATCCAGTAATAATTTTGACCCTGAGAGATTCTTGGAT
GCCGCTTATCCCGAATTAGGCCAAGAAGATACTTAAGAGTCAAATGCTTACAGGAAGCAT
TAAAAAAGAGACAGCAAACTTGAACTTAAAAAAGTGGAGGGTTGTTCACTTCATAAATAG
GGGATGACTACATTGTTAGTGATATTAGACCCAGTAAGAGGAGAAAGAAGTAAGTTATTG
ATTTTATTTTATTGCTATAGAGCTTAAAATCCGGATGGAGATCATTAAAAAGATGATCTA
ATTATTGAATCGTTTGAAGGGCCGACTTTAAAAAACTAAGGATAGCTGCCTAAAGAGATA
AATTTCTCTTAAATCTAAGATGGCTTAGAAATGCCAGAAACGATCACTTTTACTAATACT
TTAACTTACGGAAGAATCGTGGGGCAACCGCCAAAAGAAAAACAGGATAAAGATGCTCCA
GATCTAGTCAAATATAAAAAGGGGAATGGTAGTGTCAAAGGATTGCATTATAGAAAATAC
ATAGCTTTGGAATTGCTTTCTGAACATACTTTCGCTTGCAGCTTCCATAAATTCTTTTCA
CATGAAATGAGACTATTGATTCGATCAATAAGGAATACAAAATTTTCACCTGAAATGAGA
GTTTGGGTTATAAGCGTCCTTAATTATGAACCTTTAATGCAAGATTTGAAAAGAATATGT
TTAACAAATAATATACATATTGAAGACATCCCATAATTTGCAATAAATCTCATGAAAGTT
TAAATTCCATTTACTTTGCAAAATGGCAGAAAGTCTTAGTATGATTATAAGAAGGATCCT
ACAGTTCGATTAAAGCTGGAAGAATTTCTGCCACCTTTAATCTATCGACAGTTATATTCC
TTCCAGAGAGATGGTATTATGAAAGGAATAAAATTTAATGGAAGAATTCTAATTAATGAT
GATTTTGGCACTGGCAAGTCTCTTTAAGCTTTAGGATTATCAATAGCCTACAGAAACGAA
TGGCCGCTTTTAATTTTGTGTCCAAGGTTTTGTCAATATATGTGGAGGTATGAAATACTA
AAATGGCTACCTGGCTATGACATCAACAGAATTTAAATCATTAGGAATGATAAACAGGAG
TTTACAAGTTAGTTTCAAATGGTTATTATCCCTTATGATATCGCTGCTACAATCCCAGTG
CGAATAGAAAATTTTGGATTTAAAGTATGCATAGCAGATGAAGTCCAACTATTTAAGCAA
AGAGAGACTAAAACAAACAAAATATTAATTGAACTTATTTCAAAGATGAAAAGAGTCATT
TTATTAACAGGGAGTAATTTGACAAAGAAGCCTTAAGAGATTTATAGCATGATGAAAATG
GTTAGACCAGATATCATGCCTGGATTTTATGAATTTGGCTATAGATATTGTGATCCTCGA
CAATCATTTGATGGTATTGATTTTTCAAATGCAGGGAATATGATTGAGTTGAAGCAATTG
TTAGACAAGAGAATTCAAACAATTTTCAAGCGAAAGTATGTTTTCAATGAACTCCCAGAT
ATTGTGAGACAAAAACTTGAAGTGCACTGTGAAACATCCATAATTGTTAAAATGCAATAG
CTTTTGCTAAACTATGTAGTACCACGAGAAGTACAGAATCCTGATTTAAGCTTTTTCGAA
GAAATGTTCTTGACCTACTTTCAAACACCAGATAAAGTTTAATCGAAATTTTTATGTGAC
CCAATAGATGATAGTAAATTGAGCTTCTAGAAAAGCTTAGTTTAGATATTCAGGGATCTA
TATGATTACTCTGGTTAAGCCAAACTTAAAGCAACTTATGAAGTCATTGATAATATTTTG
GAGAATGGAATGAGAGTGCTGATATTTGGCTACCACCTGTATTTTATAACTGCAATTGAA
GATCATTTGACCAGCAAGGTCAAATTTTTATATTTGGGTAAGAATGTCGATACCGATTAC
AAATAAGATATTTGCTAAAAGTTTAACGAAGACGATTCGTACAAAGCGGTTCTTATTGAT
TTAAGCGAAGATTTGTCAGATATTCAGTTTCTGACGCCAAATACAGTGATATTATTTGCT
GAAACGTTTTGGAATTGGGACTATATGGAGAAAGCAGAGAGTTTAATTGTTACGCCAGGC
ATGAAGTCAGCAAATAATGTAATCTATCTTTTTGGGAGATACACTCTTGATGAGTACATT
TTCAAGCTTTTGTACAGACAAAATAATGAACTTTATTAATAACTTGAGCCGCTGCAACTT
GACTTAGATGATTTCAGAATAAAAGAAAACCTTGGCCAAAACTACGATGAGTTAAAATGT
ACTCAAATAAATTGGAACTCTCAATCATTCTAAACATTCTCACAAATTACTGAATAGCCA
TGCAACGATCAAAATTTAGACATAAGTAATATAGATCCCTTAGCCCCTGCAAAGATTTTT
CAAAAGGGTGGTTCAATGACGCTTGATAATATGTTTTTGAAGTAACGCATAGAAAATTAG
CACTAAGAAATGATAAACCAAAACTCAAGCAAAATTAAAAAGTAAAATAATGTAAGTCAT
AATTCAGATGATAGCTAATAATCTGATGTGAACGAGGATGACTTGGCATCTGTAATGACT
CAACAAAAACATTAAAATAATAATGATTAGAAATAAAATAAAAGCGCTTTAGAAGACATG
AAGGATGAAGACCTCATGATGTTTTTAGAAATGTGA


>Contig83.0.g2(protein)
MSDCEINFMDNDSGNDSDGPRRPAFGKVMSKGKGNHKFIKYKSKNAPSLNKAQQKFKLKD
AKKKQQNLKNIFGGTCDNEDLREEKSTKVFEEANQNEDCDQFEKELMSSKYSFKGKKGFG
YQKFGGKRGPYQRKIKMNPEDIPEEFKSRRNLQNASDDEVDDMSEFKFKKPKYNNFKKKI
VDNSESQQSSNNFDPERFLDAAYPELGQEDTQESNAYRKHQKRDSKLELKKVEGCSLHKQ
GMTTLLVILDPVRGERSKLLILFYCYRAQNPDGDHQKDDLIIESFEGPTLKNQGQLPKEI
NFSQIQDGLEMPETITFTNTLTYGRIVGQPPKEKQDKDAPDLVKYKKGNGSVKGLHYRKY
IALELLSEHTFACSFHKFFSHEMRLLIRSIRNTKFSPEMRVWVISVLNYEPLMQDLKRIC
LTNNIHIEDIPQFAINLMKVQIPFTLQNGRKSQYDYKKDPTVRLKLEEFLPPLIYRQLYS
FQRDGIMKGIKFNGRILINDDFGTGKSLQALGLSIAYRNEWPLLILCPRFCQYMWRYEIL
KWLPGYDINRIQIIRNDKQEFTSQFQMVIIPYDIAATIPVRIENFGFKVCIADEVQLFKQ
RETKTNKILIELISKMKRVILLTGSNLTKKPQEIYSMMKMVRPDIMPGFYEFGYRYCDPR
QSFDGIDFSNAGNMIELKQLLDKRIQTIFKRKYVFNELPDIVRQKLEVHCETSIIVKMQQ
LLLNYVVPREVQNPDLSFFEEMFLTYFQTPDKVQSKFLCDPIDDSKLSFQKSLVQIFRDL
YDYSGQAKLKATYEVIDNILENGMRVLIFGYHLYFITAIEDHLTSKVKFLYLGKNVDTDY
KQDICQKFNEDDSYKAVLIDLSEDLSDIQFLTPNTVILFAETFWNWDYMEKAESLIVTPG
MKSANNVIYLFGRYTLDEYIFKLLYRQNNELYQQLEPLQLDLDDFRIKENLGQNYDELKC
TQINWNSQSFQTFSQITEQPCNDQNLDISNIDPLAPAKIFQKGGSMTLDNMFLKQRIENQ
HQEMINQNSSKIKKQNNVSHNSDDSQQSDVNEDDLASVMTQQKHQNNNDQKQNKSALEDM
KDEDLMMFLEM