Identifiers and Description

Gene Model Identifier

Contig2757.0.g24

Standard Name

SNF1

Aliases

Contig2757_0_g24

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006271509.997652352281279e-57SNF2 family N-terminal domain
containing protein
SGDYPL082C0.0000000000000299873730555305MOT1 SGDID:S000006003, Chr XVI
from 404083-398480, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2757.0.g24(coding)
ATGGACAATGATTCAGGAAATGATTCTGATGGGCCCAGAAGACCAGCTTTTGGAAAAGTT
ATGAGTAAAGGAAAAGGAAATCATAAATTCATTAAATATAAGAGTAAGAATGCACCAAGT
CTTAATAAAGCTTAGCAAAAATTTAAATTAAAAGATGCAAAAAAGAAGCAACAAAATCTA
AAGAATATTTTCGGAGGGACTTGTGATAATGAAGATTTAAGAGAAGAAAAAAGTACAAAG
GTGTTTGAAGAGGCTAATAAGAATGAGGACTGTGACTAATTTGAAAAAGAGCTAATGTCA
AGTAAGTATTCATTCAAGGGGAAGAAAGGTTTTGGTTATTAAAAATTTGGAGGAAAACGT
GGACCCTACCAGCGCAAAATAAAAATGAATCCAGAAGATATCCCCGAAGAATTTAAAAGC
CGTAGAAATCTATAAAACGCCTCAGACGATGAAGTGGATGATATGAGTGAATTTCAGTTT
AAGAAACCGAAGTACAACAACTTCAAGAAAAAGATTGTAGACAATTCTGAGTCCTAGCAA
TCCAGTAATAATTTTGACCCAGAGAGATTCTTGGATGCAGCTTATCCCGAATTAGGCCAA
GAAGATACTTAAGAGTCAAATGCTTACAGGAAGCATTAGTAGAGAATCAATTGGTTTAAA
CAGTAGAAGATTTAGAAAAAGAGACAGCAAACTTAAACTTAGAAAAGTGGAGGGTTGTTC
ACTTCATAAATAGGGGATGACTACATTGTTAGTGATATTAGACCAAGTAAGAGGAGAAAG
AAAGCTTAAAATCCGGATGGAGATCATTAAAAAGATGATCTAATTATTGAATCGTTTGAA
GGGCCGACTTTAAAAAACTAAGGATAGCTGCCTAAAGAGATAAATTTCTCTTAAATCTAA
GATGGCTTAGAAATGCCAGAAACGATCACTTTTACTAATACTTTAACTTACGGAAGAATC
GTGGGGCAACCGCCAAAAGAAAAACAGGATAAAGATGCTCCAGATCTAGTCAAATATAAA
AAGGGGAATGGTAGTGTCAAAGGATTGCATTATAGAAAATACATAGCTTTGGAATTGCTT
TCTGAACATACTTTCGCTTGCAGCTTCCATAAATTCTTTTCACATGAAATGAGACTATTG
ATTCGATCAATAAGGAATACAAAATTTTCACCTGAAATGAGAGTTTGGGTTATAAGCGTC
CTTAATTATGAACCTTTAATGCAAGATTTGAAAAGAATATGTTTAACAAATAATATACAT
ATTGAAGACATCCCATAATTTGCAATAAATCTCATGAAAGTTTAAATTCCATTTACTTTG
CAAAATGGCAGAAAGTCTTAGTATGATTATAAGAAGGATCCTACAGTTCGATTAAAGCTG
GAAGAATTTCTGCCACCTTTAATCTATCGACAGTTATATTCCTTCCAGAGAGATGGTATT
ATGAAAGGAATAAAATTTAATGGAAGAATTCTAATTAATGATGATTTTGGCACTGGCAAG
TCTCTTTAAGCTTTAGGATTATCAATAGCCTACAGAAACGAATGGCCGCTTTTAATTTTG
TGTCCAAGGTTTTGTCAATATATGTGGAGGTATGAAATACTAAAATGGCTACCTGGCTAT
GACATCAACAGAATTTAAATCATTAGGAATGATAAACAGGAGTTTACAAGTTAGTTTCAA
ATGGTTATTATCCCTTATGATATCGCTGCTACAATCCCAGTGCGAATAGAAAATTTTGGA
TTTAAAGTATGCATAGCAGATGAAGTCCAACTATTTAAGCAAAGAGAGACTAAAACAAAC
AAAATATTAATTGAACTTATTTCAAAGATGAAAAGAGTCATTTTATTAACAGGGAGTAAT
TTGACAAAGAAGCCTTAAGAGATTTATAGCATGATGAAAATGGTTAGACCAGATATCATG
CCTGGATTTTATGAATTTGGCTATAGATATTGTGATCCTCGACAATCATTTGATGGTATT
GATTTTTCAAATGCAGGGAATATGATTGAGTTGAAGCAATTGTTAGACAAGAGAATTCAA
ACAATTTTCAAGCGAAAGTATGTTTTCAATGAACTCCCAGATATTGTGAGACAAAAACTT
GAAGTGCACTGTGAAACATCCATAATTGTTAAAATGCAATAGCTTTTGCTAAACTATGTA
GTACCACGAGAAGTACAGAATCCTGATTTAAGCTTTTTCGAAGAAATGTTCTTGACCTAC
TTTCAAACACCAGATAAAGTTTAATCGAAATTTTTATGTGACCCAATAGATGATAGTAAA
TTGAGCTTCTAGAAAAGCTTAGTTTAGATATTCAGGGATCTATATGATTACTCTGGTTAA
GCCAAACTTAAAGCAACTTATGAAGTCATTGATAATATTTTGGAGAATGGAATGAGAGTG
CTGATATTTGGCTACCACCTGTATTTTATAACTGCAATTGAAGATCATTTGACCAGCAAG
GTCAAATTTTTATATTTGGGTAAGAATGTCGATACCGATTACAAATAAGATATTTGCTAA
AAGTTTAACGAAGACGATTCGTACAAAGCGGTTCTTATTGATTTAAGCGAAGATTTGTCA
GATATTCAGTTTCTGACGCCAAATACAGTGATATTATTTGCTGAAACGTTTTGGAATTGG
GACTATATGGAGAAAGCAGAGAGTTTAATTGTTACGCCAGGCATGAAGTCAGCAAATAAT
GTAATCTATCTTTTTGGGAGATACACTCTTGATGAGTACATTTTCAAGCTTTTGTACAGA
CAAAATAATGAACTTTATTAATAACTTGAGCCGCTGCAACTTGACTTAGATGATTTCAGA
ATAAAAGAAAACCTTGGCCAAAACTACGATGAGTTAAAATCCATGCAACGATCAAAATTT
AGACATAAGTAATATAGATCCCTTAGCCCCTGCAAAGATTTTTCAAAAGGGTGGTTCAAT
GACGCTTGA


>Contig2757.0.g24(protein)
MDNDSGNDSDGPRRPAFGKVMSKGKGNHKFIKYKSKNAPSLNKAQQKFKLKDAKKKQQNL
KNIFGGTCDNEDLREEKSTKVFEEANKNEDCDQFEKELMSSKYSFKGKKGFGYQKFGGKR
GPYQRKIKMNPEDIPEEFKSRRNLQNASDDEVDDMSEFQFKKPKYNNFKKKIVDNSESQQ
SSNNFDPERFLDAAYPELGQEDTQESNAYRKHQQRINWFKQQKIQKKRQQTQTQKSGGLF
TSQIGDDYIVSDIRPSKRRKKAQNPDGDHQKDDLIIESFEGPTLKNQGQLPKEINFSQIQ
DGLEMPETITFTNTLTYGRIVGQPPKEKQDKDAPDLVKYKKGNGSVKGLHYRKYIALELL
SEHTFACSFHKFFSHEMRLLIRSIRNTKFSPEMRVWVISVLNYEPLMQDLKRICLTNNIH
IEDIPQFAINLMKVQIPFTLQNGRKSQYDYKKDPTVRLKLEEFLPPLIYRQLYSFQRDGI
MKGIKFNGRILINDDFGTGKSLQALGLSIAYRNEWPLLILCPRFCQYMWRYEILKWLPGY
DINRIQIIRNDKQEFTSQFQMVIIPYDIAATIPVRIENFGFKVCIADEVQLFKQRETKTN
KILIELISKMKRVILLTGSNLTKKPQEIYSMMKMVRPDIMPGFYEFGYRYCDPRQSFDGI
DFSNAGNMIELKQLLDKRIQTIFKRKYVFNELPDIVRQKLEVHCETSIIVKMQQLLLNYV
VPREVQNPDLSFFEEMFLTYFQTPDKVQSKFLCDPIDDSKLSFQKSLVQIFRDLYDYSGQ
AKLKATYEVIDNILENGMRVLIFGYHLYFITAIEDHLTSKVKFLYLGKNVDTDYKQDICQ
KFNEDDSYKAVLIDLSEDLSDIQFLTPNTVILFAETFWNWDYMEKAESLIVTPGMKSANN
VIYLFGRYTLDEYIFKLLYRQNNELYQQLEPLQLDLDDFRIKENLGQNYDELKSMQRSKF
RHKQYRSLSPCKDFSKGWFNDA