Identifiers and Description

Gene Model Identifier

Contig8018.0.g72

Standard Name

SNAPC3

Aliases

Contig8018_0_g72

Description

snRNA-activating protein of 50kDa MW C terminal

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12251 ) snRNA-activating protein of 50kDa MW C terminal
  • ( pfam07299 ) Fibronectin-binding protein (FBP)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003170100.000000030002053728821195hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8018.0.g72(coding)
ATGGTACCTCCTTAATAATCAGAAAAATATGATAATTCAATTCATAAAAAAGATAATTTA
AACATTAAATCTGAAGCTATTGTAAACATCACATTTTATAGCTAAATATAGAGTGTAAAA
GAAACTGAATTTTAGTGCTTAGCAAATAAAGCTACTCTTGAAGATTTGGCTTTAAAAGTA
AATTGTGTCGGTACAGATCAAATATAAACTGTTAATAAGAACAAAGATGTGGAATTTTTT
CTGATTCAAAACCAAATATATTGTTCACCTAAAAATGTTAAGTCAATCTAAAAATATTTA
AGCGAGAATTTAGATGAAAATGAAGCACTATACCCAATTAATTTCACCACAACTAGAATT
TCTGATTTGACTTTCAAAATTGGCTACCCCTACTTATTTAGACATTAGGGAAGTTGCGAT
CACATTTTCATCTTTAACATTATGCGTTTAGCTGATCCATCATAAGATCAGCCTCTTCTT
TAAAACTCAGAAGAAAATTAAGGCATCATCTAAACTTTCTAGAGCAAGAACAGAAGACAG
GTCTGTGAATTGTGCGATTTTAAATTCGCAATTATGGCCATAGTTTATCAGAATTCAGAG
CATGGAAATGACTTTTAACATAAAGCTGCTTTTGTGTGCTTAGATTGCTATTCTAAATAC
ATTAATGGTACAAAGCATAAATTATACCCTTATATCAGTAATGAGAAATGA


>Contig8018.0.g72(protein)
MVPPQQSEKYDNSIHKKDNLNIKSEAIVNITFYSQIQSVKETEFQCLANKATLEDLALKV
NCVGTDQIQTVNKNKDVEFFLIQNQIYCSPKNVKSIQKYLSENLDENEALYPINFTTTRI
SDLTFKIGYPYLFRHQGSCDHIFIFNIMRLADPSQDQPLLQNSEENQGIIQTFQSKNRRQ
VCELCDFKFAIMAIVYQNSEHGNDFQHKAAFVCLDCYSKYINGTKHKLYPYISNEK