Identifiers and Description

Gene Model Identifier

Contig8040.0.g45

Standard Name

SMNR

Aliases

Contig8040_0_g45

Description

Tudor domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001618309.000751454575209e-33conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8040.0.g45(coding)
ATGGCAGATAACTCTTTTTAAAGAAATTTAACTTCAGATAACCAAAATCATCAAGTTAAG
AAGAAAGCTTTTTACGAAAGCGACTCTGATGAGGAGGCCGCTCCAGTCTAAACTTAGATG
TAGCCCCCAAATCAGGGACTACCTGTAAACTAGCAAACTACTCTAGTTGCTCAATCAAGA
TTTTCAAAAAGTGAAGTAGTTGGGACTAGTAATATCATAAGCAGTGATCCTAGAGAAGAG
ACTAAAAGTTCAATCAATAATTAAGCTCAAAATCATGAAGACGAATTCCAAAAAATCTCT
ACTCTTTAAGGTAAAGATCAAACTAAGATAAATACTTAGATTATTCCACAGATTGTGATG
AGTGATGCTGATAAATTAAAAATGTCTCAGTTAGAGAATACCATTAATGAATACAAAACT
TAAATGAGCAAGCTTGAGAGGCTTCTTAAGGAGGATCAGGACTTGATTAATGATCCTGAC
AAAAAAGAAGAAGCTGAGAAAATTCGAGATTAACTAAGTGAAAACCTTATCTTGCAACTG
AATGAGCTAAAGTTTCTGCAAAATTAATAGGTAACTTTGTCAAAGAAAATTCATTCAGAT
AGGGTTTGCGAAGGTTACTTCTCAAGTGAGAAAACTTGGTATGCTGCTTTAATTCTGGAA
ATTTTCGAGGAAACTCAGGAAGCAGAAGTAGCATGGATTGGTTATAAGTCTCAAGAGAAG
CTCAACAAGAAATTCTTGAATGTCCTGTTTCCACCAAATCCAAATGATCTGTTTGAAGGT
GCGTTATGCAATGCAGTGTTCGCTCAGGATGGAATGTGGTATCCATGTGTTGTTGAGAAA
ATCGTAAATGATGAGAAAAATAGCAACGATGTCTCCCCAGAGTTAAATGCTATTCTCTCA
AAATACCTTGTCAAATTTAAGCACAACTAAGTGAAAGCTACTGTACCTTTGGACTACATT
CGTATCACTAGAGATCAAATGATTACTAATGCTACTAGAAGATAGCAAATTTTAAACGGT
GATGATGAAGATTAAATCGTTGGAGATTTCGCTATTCCAGAACATTTAAGGTTAAAACGT
GGAGATACTGAGAAAGCTAAGCTTTAGAAAAGAAAGAAGGTTAAAGCTCTTAAGTATACC
CATAAAGTAAAGATTTAGGAAGTAGACTCTAAAGCTAGACAGAGTACTTGGCTAGATTTT
ACAAATAAAGCTGTGAAGCAAAAGTAGGGTCATTTTGCAACAGCGAAGAACACCGAGTCT
ATTTTCAAGTCTCCAGATACTGTAATGGGAAAAGTAGGAGTTGTTGGAAGTGGCAAAACA
ATGACAGCTTATGAAACTTAAAAAATAAAATATCATGAGAAATTAAAGAATGAAGGTCCA
AGCGATGATTTTAGAGAAATTGAGAATTCGCAGTCATTTAAGAGATCAAGATTTAACTGA


>Contig8040.0.g45(protein)
MADNSFQRNLTSDNQNHQVKKKAFYESDSDEEAAPVQTQMQPPNQGLPVNQQTTLVAQSR
FSKSEVVGTSNIISSDPREETKSSINNQAQNHEDEFQKISTLQGKDQTKINTQIIPQIVM
SDADKLKMSQLENTINEYKTQMSKLERLLKEDQDLINDPDKKEEAEKIRDQLSENLILQL
NELKFLQNQQVTLSKKIHSDRVCEGYFSSEKTWYAALILEIFEETQEAEVAWIGYKSQEK
LNKKFLNVLFPPNPNDLFEGALCNAVFAQDGMWYPCVVEKIVNDEKNSNDVSPELNAILS
KYLVKFKHNQVKATVPLDYIRITRDQMITNATRRQQILNGDDEDQIVGDFAIPEHLRLKR
GDTEKAKLQKRKKVKALKYTHKVKIQEVDSKARQSTWLDFTNKAVKQKQGHFATAKNTES
IFKSPDTVMGKVGVVGSGKTMTAYETQKIKYHEKLKNEGPSDDFREIENSQSFKRSRFN