Identifiers and Description

Gene Model Identifier

Contig19312.0.g112

Standard Name

SMC4a

Aliases

Contig19312_0_g112

Description

RecF/RecN/SMC N terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004464002.9990203769197855e-115SMC family, C-terminal domain
containing protein
SGDYLR086W6.002077021906841e-60SMC4 SGDID:S000004076, Chr XII
from 302243-306499, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19312.0.g112(coding)
ATGCCAAAATAATAAGACAACAAAAAATAGCAATAAAAAGAATTCCCGCAATATTAAGAG
GAGGACAAAGTTTAGATCGATACATCTACAAAGCCAAATATCGAGAAATAAAGTTATCAA
GTTTTAAATCCAGAATCGTATACTTTCCTTAATAACTAAAAATCAATGCATTAAAACTCA
TCATTTATTGATTAAGATCTATAGCCAGCCCCTACGACAACTCGTAGATTAATGATAGAA
TCTATAGTATTAGAGAACTTTAAGTCCTACTTTGGCAAGAACGAAATAGGTCCCCTCCAT
AAAAGTTTCAGTGCTGTGGTAGGTCCTAATGGCTCAGGGAAATCCAACTTAATTGAGTGC
CTACTTTTTGTGTTTGGTAAGAGAGCCAAGCAAATGAGATCGGATAAATTGCAGCAACTT
ATACATAATAGTGCTTTACATCCTAATGTGCAGAGTGCCTCTGTAAAAGTCAGATTCACT
GATATCATAGATGACGAGAACGAAGTATTCGAATATGAAAGAGTGCCTAATACGCAATTT
GAGATATCAAGGACTGTATATAGAAATAGTAATACAAGATATTTCATTAATGGTGAAGAA
TCAAGCTTCAAAGACGTATGTGAATTGCTTAAGAAAAAAGGAATCGATCTCGATCACAAT
AGATTTTTAATCCTCCAAGGTGAAGTTGAACAGATTTCACTTATGCCACCTAAAGGCCTC
AAAGAAGATGAGGTAGGCCTACTAGAATACCTCGAAGATATCATCGGGACCACACATTTG
AAGCCTCGTCTCACAGAACTGGAAGAAAAATTGAAAAATCTCGATGAAGAGAAATCTCTG
CGATACAACACACTCTCCTCCCTCGAAGATTCACTCAAATCTATAGAGAGCGAGAAGGAC
AAAGCCATTGATTGGCTGAATAAACAGAGAGGGCTTTATTAACTGCAAAATATGATGAGT
TAGGTTCAAATCGCATCAGCGAAAGATGACCTCGATTAGTTGAAGGATAAAATCCAAAAG
AAAAGAACAGAAGCAAAAGAAAAGAGGGATTAGAAATAGTAATTCAGGCTCTAAAATGAG
GAGATTTTTAAGCAGATTAACAAAATAAGTGACATCAATAAAAATTTTGACTAGAAAAAA
GAGTAGCTTTAAGAACAGTTTAAGCAGCTTAGTAAAAGAGATGAAAAGGTGCGCTTTGAA
ATGCGAAGACTTGCATAACAAATTGAGATGAACAGAGAAAACATAAGAAATCTGGAATTG
AGAAAAGAAAACGAAATAAGAATTTTTACAGATAATGACAAGGATTTACCTTAAATCTTG
GAAGATTTGAGAGAAAAGCATGAGGAGTTGGAGAATACTGAGAATGAATATGATTAGCAG
GAGTATAACATGAAAGACTAGACTATGCAGCTTAGAGAGAAAAAAAAGAATCTAATTGAC
TAAATAAGACCACATTAATAAGAGAGAGCAAGGCTTTAATAAGACATAAACACAAACAAA
AGAATAGTAAGCGAGTTTGATGAAAGGAAATCTATGTTAAACCGTAGAAGTGAGGATTTA
GAGCAGAAGCTTTAGGAACTTCAATTCAAAGTGAATAGCATAAACGATAGGATTGGAGTG
AACACTGAATAAATAGAGAGACTCTAGGCCATGTAAGTGGACTTAGAAAAGAGCCTTTAG
AATCCAGAAGTCGATGTTTAATAGTTAGAGAGAGACTTGGAGAGAAAGAAAACTAAATTG
AAGATTGCTCAAGATACTATACAAAAGAATAAGCAGAGAAACATAAACTTGAGTGAATTG
ATGAACGCTCAAAGAAGAGGTGAGTTAAGTGGAATCTATGGTAGATTAGGGGACCTGGGT
TAAATTGATATGATATATGATACAGCAATCACTACAGCCAGTAAATATTGGGATTTCATA
GTTGTAGATACTATGAGGTCTGGTGAAAGATGTGTCGAATACTTGAATCAAAATAGAATT
GGATATCAAGGTTTCATCATGCTAGATAAACAAAATTAATCGCTATATAACTAATTGAAT
AGACCCTTCAGAGCACCATAAGGCTCGAAGAGACTCATCGATCTCATTTAAGTTGACAAG
CCTGAACTAGAAATCGCTTTCTATTTTGCAATAAGAGATACATTAGTTTGTGAAGATTTA
GACACCGCTACTAGGATTGCTTATTATTCGGATCAGAAATACCGTGTTGTTACATTGGAT
GGTACATTAATTGAACTAACTGGCACTATGTCGGGTGGTGGCAAAGCCAAAAGAGGAGGC
ATGAACAAACAATTCGAGAGTGAATATGAACCCGAATATTTATAACAATTATAGCAGGAA
ATCGAGAGAATAGAGGCTTTAGTAATTGAGCACAGAGATACAAGGCCAAGATTGGAATAC
AACTACAATTAGAATCTAAGATAAATTAATAACTTAGAATAAGAAAATCGTAGAAGTATA
ATAGAAGTGCAGTCACTAGAGGAAAATCTACAAAGAACCAAGAATTAGTACTAAGTTCTA
GTTAATGAAAAGCAAGAATTGGACAAAGAAGAAGTTGACAAGATAAATCCAATAAAGATC
TAAATAGGCCAAGCACATCAACACTTAGTCCTTATACAACCAAAGATTGAAGAACTTTAG
CAACAGTTAAGTTTAATAGAGACTTAAATCTACAACATGGCAGATTAAAAACTTAAAAAG
TTGAGAGACAATATGGAGAGACTCAAGTAAGAGATTATTGAGCTTTAGAGAGTCAAAGCT
TAAAAAGAGAATTTTTAAGATAAATTCAATGCTAGTATTAAAAATATCGATAGGTAAATT
TTAGAAGAATAAAAACTTATTGATGCCCTTTAAGTGAAGATGGACAAGTACAGATAAGCA
ATCAATTAAATAACGTTAGAAGGAGAGCAGATTCTTAATAAATAAAATGAAATTGATGAG
GAGAAAGATTAAGCAACAAAGTAGTTATTTTCCAAGAAATAAGATTTTAGAAAGTTTAAT
GAACTAATGTCTAAAAATACTCAGGAGTACGAGGCAATAAAATAAGAAGTACTTGAACTA
TCTGGTAAAATATTTAAGCTAGAAGAATAACTCCTGCGTTTACAAGAGTTCAAAGATTCT
GTACTCTAAAAATGTGATGCCCTAGTTTAAGAATGGCAGATAGTTTTTCAAGAAATCGAT
AATGTGCAGAGAAGTGTTCAAGGAAATCATTAATTTCCCATGAAAACTGAAGAAGATGGA
GACGGAGAAAAGGGATAAGGGGATGACTAAGAGATAAGTGCATTTATGGATTAGGATGAG
ATTTAGACTATTAGAAATAGGTAAAGAAGGAGAATAGACTATAGCCTGATGACAAGAGAC
GAAATAATTGAGTACTTGATGAATAACGTAGATATTCATGAAAATTTTGACATTGAATAA
ATCAAAATATTGGAGCCTCATCTGCAACACATTAGCAATTTGATCATCATACTTTAGTAA
TAAATTGATGCTTAACCATTGAATTCAAGAATCATTGAATAGTACCAATCGAAGTCCTCT
GATTTAATAGGTCTTAGGAACTAGATTGAACAAAGATCAGAAGATGTCACAGCTTTAAGG
AATGAATTCTATGAACTTAAATAGCAACGAATAATTCAATTCAAAGTAGGGTTTGAGTTT
ATCGCCATAAAGTTGAAGGAAATTTACAGATTTATCACAAAAGGAGGTGATGCAGAACTT
GAATTAGTAGACGCTCATGATCCATTCTCAGACGGTATCTCTTTTCATGTGAGACCTCTA
AAGAAATCTTGGAAGGAAATGAAAAATCTCTCTGGAGGAGAGAAGACTATCAGTTCTCTA
GCACTCATATTCGCTTTGCATCACTATAAACCCAGTCCACTCTATTGCATGGATGAAATT
GACGCTGCTCTAGATTATAAGAATGTTGCTATCGTTGGTGAATACATCAAGCAGAGAACA
AGAAACGGCCAGTTTTTAGTGATAAGTTTAAGAAACAATATGTTTGAGTTAGCAGAGAAA
TTATTTGGCATATACAAAACAAAAGATATGACAAAAACTGTCTACTTAATCCCAAGCTAG
ATGCAAAACATGGTTGATAAAGCTAAATAAAAAAGAGAAATATTGGACTAATAAAATCAA
AGAGATCAATTTGAGAATGACCAGGATATGATTTAAGTCTGA


>Contig19312.0.g112(protein)
MPKQQDNKKQQQKEFPQYQEEDKVQIDTSTKPNIEKQSYQVLNPESYTFLNNQKSMHQNS
SFIDQDLQPAPTTTRRLMIESIVLENFKSYFGKNEIGPLHKSFSAVVGPNGSGKSNLIEC
LLFVFGKRAKQMRSDKLQQLIHNSALHPNVQSASVKVRFTDIIDDENEVFEYERVPNTQF
EISRTVYRNSNTRYFINGEESSFKDVCELLKKKGIDLDHNRFLILQGEVEQISLMPPKGL
KEDEVGLLEYLEDIIGTTHLKPRLTELEEKLKNLDEEKSLRYNTLSSLEDSLKSIESEKD
KAIDWLNKQRGLYQLQNMMSQVQIASAKDDLDQLKDKIQKKRTEAKEKRDQKQQFRLQNE
EIFKQINKISDINKNFDQKKEQLQEQFKQLSKRDEKVRFEMRRLAQQIEMNRENIRNLEL
RKENEIRIFTDNDKDLPQILEDLREKHEELENTENEYDQQEYNMKDQTMQLREKKKNLID
QIRPHQQERARLQQDINTNKRIVSEFDERKSMLNRRSEDLEQKLQELQFKVNSINDRIGV
NTEQIERLQAMQVDLEKSLQNPEVDVQQLERDLERKKTKLKIAQDTIQKNKQRNINLSEL
MNAQRRGELSGIYGRLGDLGQIDMIYDTAITTASKYWDFIVVDTMRSGERCVEYLNQNRI
GYQGFIMLDKQNQSLYNQLNRPFRAPQGSKRLIDLIQVDKPELEIAFYFAIRDTLVCEDL
DTATRIAYYSDQKYRVVTLDGTLIELTGTMSGGGKAKRGGMNKQFESEYEPEYLQQLQQE
IERIEALVIEHRDTRPRLEYNYNQNLRQINNLEQENRRSIIEVQSLEENLQRTKNQYQVL
VNEKQELDKEEVDKINPIKIQIGQAHQHLVLIQPKIEELQQQLSLIETQIYNMADQKLKK
LRDNMERLKQEIIELQRVKAQKENFQDKFNASIKNIDRQILEEQKLIDALQVKMDKYRQA
INQITLEGEQILNKQNEIDEEKDQATKQLFSKKQDFRKFNELMSKNTQEYEAIKQEVLEL
SGKIFKLEEQLLRLQEFKDSVLQKCDALVQEWQIVFQEIDNVQRSVQGNHQFPMKTEEDG
DGEKGQGDDQEISAFMDQDEIQTIRNRQRRRIDYSLMTRDEIIEYLMNNVDIHENFDIEQ
IKILEPHLQHISNLIIILQQQIDAQPLNSRIIEQYQSKSSDLIGLRNQIEQRSEDVTALR
NEFYELKQQRIIQFKVGFEFIAIKLKEIYRFITKGGDAELELVDAHDPFSDGISFHVRPL
KKSWKEMKNLSGGEKTISSLALIFALHHYKPSPLYCMDEIDAALDYKNVAIVGEYIKQRT
RNGQFLVISLRNNMFELAEKLFGIYKTKDMTKTVYLIPSQMQNMVDKAKQKREILDQQNQ
RDQFENDQDMIQV