Identifiers and Description

Gene Model Identifier

Contig17078.0.g58

Standard Name

SMC3

Aliases

Contig17078_0_g58

Description

RecF/RecN/SMC N terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJL074C3.998479955315009e-46SMC3 SGDID:S000003610, Chr X f
rom 302849-299157, Genome...
T. thermophilaTTHERM_002948109.9981864321491e-40SMC family, C-terminal domain
containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17078.0.g58(coding)
ATGTTTATCAAAAAGGTGATTGCGCAAAACTTTGTGAGCTACAGAGAACTCCAGATGAAG
GAAGACCTGCACCCTGGTTGCAACTTAATTCTGGGGTATAATGGCTAGGGCAAGTCTAAC
TTCTTGCAAGCCATAATCTTCGCATTAAGTGATATACAATCGAAAAAGACGAAACAGGAG
CGTGCTCTCATGCTTAATAACAGAGCAGAGAACCGTGAATACTCAGTTGAAGTGACTCTG
GACAATAGTCGTCAGAAAATTCCAGTGGCTGGTGATGAGATCGTGGTGAAGAAGATTTAC
AACTGCGACACAGACAAGGACGTTTATCTCTTAAATGGCTCTCATATAAACGAGCGGGAG
TTGTTCAATTTGTTTGAGAGTGGTGGCTTCTCACTATCAGGATAATCTCAATTCCAGATC
GTGCAGTAAGGGCAAGTAGAGTAACTGGTTCTTCAAGGTGAGGAAGGTTTCTTAAAGATG
CTGAAGGAAGTCACTGGTACAGAGTCATTCGATAACAGAGTGGAAAAGATGAACACAGTC
CTATCTGATTGCAAAACCAAGAAAGATTAGCTTGAAAAGATCCTTAGCTCAATCAAAGAG
AGGCTTGACTAACTCGGTAAGGAAATTGAAGAGTACAGAGAGATCCAAAAGATCGAAAAA
GAGAAGAAGGGCTTGGAACTATCTATTCATACACACAAGACTCAGCTTAATCTCAGAGAG
ATCGAAAAACTCCGCCAACAAAAATCAGTCATGATGGAGGAGAGACAAGAGTTAATTAAC
AGACAGTAAGACTTCCTAATAGAAAACTCAAATCAGAAAGAGAGCATTGACTCACTTAAG
AGTTAGATACAGCTACTAGAAGCTAAAATTGAGAATCTTTAGCAGATGAGGAATGAATTC
CTGAATACTATGGTAGATCAGGAAAATAGTGCCAAGCAAAGAAAAGACCAGAAGACTCTG
TTTGATTACTTCACTAACTCCTACGATCAATAACTAAAGCAACTTAGTTAAGGTGTATAG
ATGATAAATTAGGAGATTCAATCTCTACAAGGTAAGAACCAAGATCTTGAAAGTGAGATT
GAAAAGATCAAGCATAAGCAGAGTGAACTCATGAGAGAAAAAGAGATACTCTTGATCAAG
AGAGAGACCATAGAAAAGTTCTAGAACCCTCAATAGAGAAAGAAATTCTTCTAAGATGAG
TCTAATAAGATTCAAGTACAAATTGCATCAGTTGTCAAAGATAAGGATGATTTAACTAAA
AACTTAGAGCAATCTCAGAAAAAAGCTCAAGACATGACTTCAAGAATTGCTCAAGAATAA
AAAGATGAAGAGACTATCACTCATAAAATCAAAAATCAATCACAAGACTTGCATGTCTTC
CATGATGAGAAGCGGAAAGTGGCCTCTTAATTGAAGTCACTCATATTCCAGAAAAATGAG
TATGATATGGAGATTAAGGCTTTAAAAACTAAGTATCAAGGGGAAGTCGAAGCTTTAGAG
AAACTAGATCCTATTTTTAGCACATTAAAGAGACTGAGAGCTTAGATTAAAGAAAAGCAA
GTGAAAGGCTTTAAAGGCTTTTTGATTGATTTTCTTGACTGTGAAGATTTGAGATTCAGC
GCATGCATTGATCTTGCTGCTAAGTCAAAACTATTCTCAATAATAGTTGATGATCTTGAA
GCTGCAAGAGAAATATTGGCAATCAATGATTAAATCAAAGGTGGAGTGATAAACATTTTC
CCATTGTCTATCATGGAGAACACCCCTGTAAAACCCAGAGATTACCCTCAATCAGATGAA
GTGCGTCCACTTACAAATTAAGTGAGATTAACTAACAATGCAGACCCCAGACTTGAACGC
TTGATCTTGAGTATATTTGGCAAAGTGGTGTTAGTAAGAAACTACGCCCTCGGTATGCAG
ATAGCGAAGGACTACAACTTGACATGTGTCACACCAGATCTACAAATCATCTATGCTGGT
GCTTTTATTACAAGAGTAGGCTAGTACAATAAGTCACAGAACGACAGAGTGTCATTGTAC
AGGAAAGTCTCTATCATCTAGAATCAAGTTGAATAAAAGATGGCAGGCATCGTCTAGATT
GATGTTGAAATAGATAAGCAGAGAAATAATGATATAGAGGCAATGAGGAAGATTGCAAAG
AGCGACGTTTCGCTTAACAACCTTAAAAGCTCTTTGACTCAAAAGAAAACTGCAATCTAA
GATTACCAGCAATAAACAGAAAGAAGCAAGTAAGGAGGCTAAGAATATCAAAAGTAAATA
GGATACCTCAATTATCAAGAGCAGCAATTGAGAGATTAACTCAAAGATCTTGAGAAGGAA
TCACAATCATAGGCTAAGTAATTCTCTGAATAGGAATCTAATAGATTAGTTTTCCTAAAT
AAAACTCTCGATGACTTATCTAGATAATTGCAAGATAAGGAAGCAGAGAGAAACCAGCTA
TCTACTCAACTTTATCATGCAAAATCCTTGCTCAATGAAAATTACTTGAAGAAGCAAAAT
GATCTATAATAACAAATTCTTGAATAAGAGATTGACGTTAAAATGGGTGAAGGTCGTAAA
TCACTTGATAACTCCTAAAGCGACCATAAGGCTACTGAAAGAGATGTTGATAAAGTTGAG
AGAGAACTTTAATCATTGAAATCTCAGCATGAATCACGCATCAATGAGCTTTAAAACTTG
CTGCAAACAATTGAAGTTCAAGGTGATAATGAGATTCTTCATAACGATTTAAGAGATAAA
GCAATGAAGATATCTGAAGTAAGCATGAAAATAGATGAACTTTAGGCAAGTAACTAGTAG
TTAGACATAGCAATAAAGAAAATTGATGTAAATTTCGACAGAGATACTTTTGAGCACGCA
TTGAAAGAATTTGATGAGAAGAAAGTCAGATATGAAATCAATCTAAAGGGTATTGAGTTA
GAGAAATTCCCTAGAATGAACAGACATTGCGTTGAATGGTTTGACAAATACTCAGCAAAG
CACCAAGAACTTATTAGAAAGTTTGAAGATCAGCTCGAAACAGAGTAAGGAATGATCAAA
TTGTTGAGTGACTTAGATTCGCAGAAGCAGCAAGCTCTTGAAAAGAACTTTATCAGACTG
AATGAGAATTTCCTTGAGATATTTTCAAGAATTGTGCCAAATGGCAGAGCTGAGATGAAA
CTCGTAAAGAGAGATTAAGGAGACGAATCTTAAATTTCTCATCCTTCCCAGTTCAACGAG
CCCTCTCAAGTCATGAAGATTGGTTAACAGATGTACAAAGGCATCAAAGTGAGAGTCTCT
TTCTCTGGCCAGAATAATCAGCTTGAGGGTCTTGCTCATTTGTCTGGAGGGCAAAAAGCT
GTGGTGGCTGCCTCGCTATTATTTGCTATTCTAAAGATTGAAGCTGCACCATTCTATATT
ATGGATGAGTTTGATAATGCTCTTGATGCTGAATTTAGAGGGGCAATTGCAGATTTGATA
TTTGAGTTGTCTAAGTAATCATAGTTCTTGATCACAACATTCAAGCCAGAGTTGATAGAA
GGCGCAGATAGACTTTATTAGGTTAAGACCAAGAACAATGCCAGTGAGATTAGATAAATT
GATGTCAAGAAAGCTAATGAAATAATCAATAAAAAGGATCAGTGA


>Contig17078.0.g58(protein)
MFIKKVIAQNFVSYRELQMKEDLHPGCNLILGYNGQGKSNFLQAIIFALSDIQSKKTKQE
RALMLNNRAENREYSVEVTLDNSRQKIPVAGDEIVVKKIYNCDTDKDVYLLNGSHINERE
LFNLFESGGFSLSGQSQFQIVQQGQVEQLVLQGEEGFLKMLKEVTGTESFDNRVEKMNTV
LSDCKTKKDQLEKILSSIKERLDQLGKEIEEYREIQKIEKEKKGLELSIHTHKTQLNLRE
IEKLRQQKSVMMEERQELINRQQDFLIENSNQKESIDSLKSQIQLLEAKIENLQQMRNEF
LNTMVDQENSAKQRKDQKTLFDYFTNSYDQQLKQLSQGVQMINQEIQSLQGKNQDLESEI
EKIKHKQSELMREKEILLIKRETIEKFQNPQQRKKFFQDESNKIQVQIASVVKDKDDLTK
NLEQSQKKAQDMTSRIAQEQKDEETITHKIKNQSQDLHVFHDEKRKVASQLKSLIFQKNE
YDMEIKALKTKYQGEVEALEKLDPIFSTLKRLRAQIKEKQVKGFKGFLIDFLDCEDLRFS
ACIDLAAKSKLFSIIVDDLEAAREILAINDQIKGGVINIFPLSIMENTPVKPRDYPQSDE
VRPLTNQVRLTNNADPRLERLILSIFGKVVLVRNYALGMQIAKDYNLTCVTPDLQIIYAG
AFITRVGQYNKSQNDRVSLYRKVSIIQNQVEQKMAGIVQIDVEIDKQRNNDIEAMRKIAK
SDVSLNNLKSSLTQKKTAIQDYQQQTERSKQGGQEYQKQIGYLNYQEQQLRDQLKDLEKE
SQSQAKQFSEQESNRLVFLNKTLDDLSRQLQDKEAERNQLSTQLYHAKSLLNENYLKKQN
DLQQQILEQEIDVKMGEGRKSLDNSQSDHKATERDVDKVERELQSLKSQHESRINELQNL
LQTIEVQGDNEILHNDLRDKAMKISEVSMKIDELQASNQQLDIAIKKIDVNFDRDTFEHA
LKEFDEKKVRYEINLKGIELEKFPRMNRHCVEWFDKYSAKHQELIRKFEDQLETEQGMIK
LLSDLDSQKQQALEKNFIRLNENFLEIFSRIVPNGRAEMKLVKRDQGDESQISHPSQFNE
PSQVMKIGQQMYKGIKVRVSFSGQNNQLEGLAHLSGGQKAVVAASLLFAILKIEAAPFYI
MDEFDNALDAEFRGAIADLIFELSKQSQFLITTFKPELIEGADRLYQVKTKNNASEIRQI
DVKKANEIINKKDQ