Identifiers and Description

Gene Model Identifier

Contig4581.0.g73

Standard Name

SMC2c

Aliases

Contig4581_0_g73

Description

Mu B transposition protein, C terminal

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam09077 ) Mu B transposition protein, C terminal
  • ( pfam08606 ) Prp19/Pso4-like
  • ( pfam04111 ) Autophagy protein Apg6
  • ( pfam01576 ) Myosin tail
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam11932 ) Protein of unknown function (DUF3450)
  • ( pfam11871 ) Domain of unknown function (DUF3391)
  • ( pfam09486 ) Bacterial type III secretion protein (HrpB7)
  • ( pfam04582 ) Reovirus sigma C capsid protein
  • ( pfam05335 ) Protein of unknown function (DUF745)
  • ( pfam00015 ) Methyl-accepting chemotaxis protein (MCP) signalling domain
  • ( pfam13094 ) CENP-A-nucleosome distal (CAD) centromere subunit
  • ( pfam07889 ) Protein of unknown function (DUF1664)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008129508.001655364039598e-37SMC family, C-terminal domain
containing protein
SGDYFR031C1.0004783691736523e-35SMC2 SGDID:S000001927, Chr VI
from 220106-216594, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4581.0.g73(coding)
ATGCAGGTAAATAAGAAGGGGTCACCACCCATGATGAGAGATTATGATGAAATTGTAGTA
AGCAGATAGATCTTTGATGGGAAGAGCAAGTACATAGTAAATGGAAAAGTAGAGACTGGC
GATAAAATCAAGAACATGTTTATGAGTGTCTAGCTCAATGTAAATAACCCGCATTTCTTG
ATTATGCAAGGACGTATCACTTAGGTAGTCAATATGAAACCATAAGAGCTGCTATCATTG
ATAGAGGAAGCAAGTGGTACATCACTATATGAAAACAAGAAATTAGTTTCACTTAAAACT
ATAAGCAAAAAGCAATCCAAAGTGGATGAACTTACTAATATATTGATTCAAGAAATTAAT
CCACATTTAGAGAAACTCAAAAAGGAGAAAGAATACTATCATTAATTTATGCAATTTGAA
TCAGAGAAGGCTGTCTTATGGAAACAAATAGTGGCTTATGAGTACTATGGCAATGAGAAA
AATTTCTTACTCAAGTCAACCGAAATTAATAGGCTAAGAGCTGAAGGAGATGAGATGCTC
AGGCTCTAACAGTAAAGAGACTAAGAAATTCAATTTCTTGATAATGAAATTCAACAAGGA
AAGAGGAATGATATTACTCATATCAAAGTTTAGTGGGACACTATGCAAAAGGATAACCTT
AGATTAGAGAAGGATCTTGTCGATAAGTAAGGAACATTGAAAAATGTTGAGAAAACACTG
GCTGACAATGAAAGAACTCAGAAAAAACTCACTAGATATATGGACGAGCTAAGACGTACT
ATAGATAAGAATCGAAAGAGGAGAGATGAAGTAAATATTATGATCAGAAAGCTGAGGCGT
GAGTATGACTTGAAAAAAGAAAATCTAAAGTAAGTAGTTCAAAGCATCAAAGATTTGAAT
GATGGTAAAGATATATCAATCGATGACGGAGTGGGCCTAAGAGATTAGTTAAATGAGACT
CAGAAAAATTTAGAGACAACTCTTACTGAAATTAAGCAAACTCAGCATGCTATTAGAAGA
CTGGAGAGAGATAGAAATGATTTACAAGAAAATCTAGAGCACTTATCCAAAGCTAATGAA
AACATAAAATCTCAAATTTAAAAAGTCATTACAGAGCTTAAAGCTGGGAGTTGA


>Contig4581.0.g73(protein)
MQVNKKGSPPMMRDYDEIVVSRQIFDGKSKYIVNGKVETGDKIKNMFMSVQLNVNNPHFL
IMQGRITQVVNMKPQELLSLIEEASGTSLYENKKLVSLKTISKKQSKVDELTNILIQEIN
PHLEKLKKEKEYYHQFMQFESEKAVLWKQIVAYEYYGNEKNFLLKSTEINRLRAEGDEML
RLQQQRDQEIQFLDNEIQQGKRNDITHIKVQWDTMQKDNLRLEKDLVDKQGTLKNVEKTL
ADNERTQKKLTRYMDELRRTIDKNRKRRDEVNIMIRKLRREYDLKKENLKQVVQSIKDLN
DGKDISIDDGVGLRDQLNETQKNLETTLTEIKQTQHAIRRLERDRNDLQENLEHLSKANE
NIKSQIQKVITELKAGS