Identifiers and Description

Gene Model Identifier

Contig4234.0.g78

Standard Name

SMC2b

Aliases

Contig4234_0_g78

Description

RecF/RecN/SMC N terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02463 ) RecF/RecN/SMC N terminal domain
  • ( pfam06470 ) SMC proteins Flexible Hinge Domain
  • ( pfam04582 ) Reovirus sigma C capsid protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008129504.998810439563986e-161SMC family, C-terminal domain
containing protein
SGDYFR031C2.9995941501461703e-129SMC2 SGDID:S000001927, Chr VI
from 220106-216594, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4234.0.g78(coding)
ATGCAGGTAAATAAGAAGGGGTCACCACCCATGATGAGAGATTATGATGAAATCGTAGTA
AGCAGATAGATCTTTGATGGGAAGAGTAAGTACATAGTGAATGGCAAAGTAGAGACTGGC
GATAAAATCAAGAACATGTTTATGAGTGTTTAACTCAATGTGAATAACCCGCATTTCCTT
ATTATGCAAGGACGTATCACTTAAGTTGTCAATATGAAACCATAAGAGCTTTTATCTTTG
ATTGAGGAAGCAAGTGGTACATCACTTTATGAAAACAAAAAATTAGTTTCACTTAAAACT
ATTAGCAAAAAGCAATCTAAAGTTGATGAACTTACTAACATATTGATTCAAGAAATAAAT
CCACATTTAGAGAAACTCAAAAAGGAGAAAGAATACTATCATTAATTTATGCAATTTGAA
TCAGAGAAGGCTGTCTTATGGAAACAAATAGTGGCTTATGAGTACTATGGCAATGAGAAA
AATTTCTTACTCAAGTCAACCGAAATTAATAGGCTAAGAGCTGAAGGAGATGAGATGCTC
AGGCTCTAACAGTAAAGAGACTAAGAAATTCAATTTCTTGATAATGAAATTCAACAAGGA
AAGAGGAATGATATTACTCATATCAAAGTTTAGTGGGACACTATGCAAAAGGATAACCTT
AGATTAGAGAAGGATCTTGTCGATAAGTAAGGAACATTGAAAAATGTTGAGAAAACACTG
GCTGACAATGAAAGAACTCAGAAAAAGCTCACTAGATATATGGACGAGCTAAGACGTACT
ATAGATAAGAATCGTAAGAGAAGAGATGAAGTAAATATTATGATCAGAAAGCTGAGGCGT
GAGTATGACTTGAAAAAAGAAAATCTAAAGTAAGTAGTTCAAAGCATCAAAGATTTGAAT
GATGGTAAAGATATATCAATCGATGACGGAGTGGGCCTTAGAGATTAGTTAAATGAAACT
TAGAAAAATTTAGAGACGACTCTTACTGAAATTAAGTAAACTCAACATGCAATTAGAAGA
CTGGAGAGAGATAGAAATGATTTACAAGAAAATCTTGAGCATTTATCCAAAGCTAATGAA
AACATTAAATCATAAATTTAAAAAGTCATTACAGAGCTTAAAGCTGGGAGCGAAGCATTA
CAATAAAAGCAGTTTGATCCAAAGGTTGAGATTATAAAGTCTTAAGAGAAACGTAAATTA
GAAGATCAGCTTAAATAAATAAATGCCAGACTCGATGATTATTGTTCAGAATTCGGTCAT
AAAATTGAAGTTAAGTATAATGTTCCTCCAGATTTTGATTAGAGCTTGGTCAAACATAGA
GTTATAAAACTTTTTACTGTAAAAGAAGATAGATATTCAGTTGCATTAGAAACTGTGGCT
GGAAACAAACTTTACTCAATTGTTGTAGAAAATGATATTGCCTGTAGCTTGCTTATGAGA
CATCATGCTTTCAAATAATACAGAGTTGATTTAATTCCAAATAATAGAATCAAATTTAAG
GAAGTTAAGCCAGAAATTTTAGATTACATAAGAAATGTAACAAAGGGCAAAGCCAGACTT
GCTTTAGATATAATAAAATACAACCATGCTGTTGAAAATTCTATGAAACACATATTTGGG
AGTGTTTTGGTATGTGAGGACTCAGAAACTGCTAAGAAACTGGCTTTTGATCCTTATGTA
AAAATGAAGACTGTGACTATAGATGGTGACATTTATTAGCCATCTGGAGTGCTCTCTGGA
GGTTATATCCAAGTAAAGGATGGATAAGTACTTAAAAAAATTAAAGAAATCCAAAGATTA
GAAGATGAGAGACGCTTTATAAATGTTAAAATTTAAGAAGCCTAAAATGCTATTTTAGCA
CAAAGATAGTTAGCTTTTGACTATTAATAGAAGAAATCTGAGAATGAATTAAATGAACAT
TAATTGAAATTACTTAAAGAAAGACTTGAGCTAGACTAGAGAGATGCTGTAGCAATAAAG
CTTAAAAATACCGAGGAAGATCTCGACGATGCCAAAAAGAAAATAGTAAACCTATCTGAA
TTTGAGAAGAAATATAGAGAGGAGCATGAACGGCTCAGAATTGAAATCATATCTATGGAG
AGTAAAAAGGATCAGAAGAAAGAATTACTTGAAGAGATGATGGATAAGTTAAGAGCAGAA
ATAGAAAGAATCACTAAGGATTTAAAGATTTAACAAAGAGAAGGAGATCAACTGGAATTT
GCGTGCGAGGAAAATGACAAAGATCTAAAGAACTCATAGGAACAGATTACTAGAGAGATT
ATTGAAAGAGAGAAGCTGCTTGGAGAACAGGAAGATTTAAAGAGAGTTATTGAGGACTAT
ACTAAATTGAAAAATGACAAAAGAGAAAAAATGAAATAGCTTCAGTAAGAGTAGATTAGA
GCAAGTACTAGAATTAAGGAATAAATCGAATAGAAGTCAAGATTAGAGAAGCAAAAGGAT
CATAACAACTAGGAGATTAAGAAACTTGATAGTAGAATCATGAAGTTGTCTTGTGAAATG
AATGATCTCTAGAAGAAAATTAAAACCCTTGAGTAGGAAAATGGATGGATAAACACTGAG
AAGGATATGTTTGGAAACCCTGAATCTACAGAGTACAAATTTGGTCCAGATTTCAACATG
ATAGAGAAAACCCGTAGATACTATAAACTTAAAGAAGAAACTCAAACTATGAAAAAACAA
GTAAACATGAGAGTGGATCACATGGCTGACCAAGCAGAGAAGGATTACACTGAACTTATA
AAAAAGAAGGATAAGTTAATGGTAGATAAAGAACACATCGAGAAAACTATCGAAGAGCTC
GATACTCTTAAGAATAAGACTTTACTTGAGACATATCAAGAAGTAAACAACAACTTCATG
AAGATATTTTCAACACTATTACCAGGAGCTGCCTGCCAATTAGAAGTTTAAGATTTGAAA
AACATTTAAGAAGGAGTGAAGCTCAGAGTTGCTTTTGGTAATGATTGGAAAGAGAGTCTT
TCCGAATTATCTGGTGGTCAGCGTTCACTACTGGCATTATCTTTTATTCTCGCTCTACTA
AAATATAAGCCAGCCCCACTCTACATTTTGGATGAGATAGACTCAGCTTTGGACTTAAAT
CACACTTAAAATGTTGGAAAGATGATAAAATAACACTTCCCAGAGAGTCAGTTTATCATT
ATTTCACTAAAGGAAGGTCTCTTCAATCATGCAAATGTACTCTTCAAAGTTGAGTTTAAT
GAGGGAAAATCAAAAATTATTAGACATTAACAACTAAAGAATGTCAAAAATAAATAATGA


>Contig4234.0.g78(protein)
MQVNKKGSPPMMRDYDEIVVSRQIFDGKSKYIVNGKVETGDKIKNMFMSVQLNVNNPHFL
IMQGRITQVVNMKPQELLSLIEEASGTSLYENKKLVSLKTISKKQSKVDELTNILIQEIN
PHLEKLKKEKEYYHQFMQFESEKAVLWKQIVAYEYYGNEKNFLLKSTEINRLRAEGDEML
RLQQQRDQEIQFLDNEIQQGKRNDITHIKVQWDTMQKDNLRLEKDLVDKQGTLKNVEKTL
ADNERTQKKLTRYMDELRRTIDKNRKRRDEVNIMIRKLRREYDLKKENLKQVVQSIKDLN
DGKDISIDDGVGLRDQLNETQKNLETTLTEIKQTQHAIRRLERDRNDLQENLEHLSKANE
NIKSQIQKVITELKAGSEALQQKQFDPKVEIIKSQEKRKLEDQLKQINARLDDYCSEFGH
KIEVKYNVPPDFDQSLVKHRVIKLFTVKEDRYSVALETVAGNKLYSIVVENDIACSLLMR
HHAFKQYRVDLIPNNRIKFKEVKPEILDYIRNVTKGKARLALDIIKYNHAVENSMKHIFG
SVLVCEDSETAKKLAFDPYVKMKTVTIDGDIYQPSGVLSGGYIQVKDGQVLKKIKEIQRL
EDERRFINVKIQEAQNAILAQRQLAFDYQQKKSENELNEHQLKLLKERLELDQRDAVAIK
LKNTEEDLDDAKKKIVNLSEFEKKYREEHERLRIEIISMESKKDQKKELLEEMMDKLRAE
IERITKDLKIQQREGDQLEFACEENDKDLKNSQEQITREIIEREKLLGEQEDLKRVIEDY
TKLKNDKREKMKQLQQEQIRASTRIKEQIEQKSRLEKQKDHNNQEIKKLDSRIMKLSCEM
NDLQKKIKTLEQENGWINTEKDMFGNPESTEYKFGPDFNMIEKTRRYYKLKEETQTMKKQ
VNMRVDHMADQAEKDYTELIKKKDKLMVDKEHIEKTIEELDTLKNKTLLETYQEVNNNFM
KIFSTLLPGAACQLEVQDLKNIQEGVKLRVAFGNDWKESLSELSGGQRSLLALSFILALL
KYKPAPLYILDEIDSALDLNHTQNVGKMIKQHFPESQFIIISLKEGLFNHANVLFKVEFN
EGKSKIIRHQQLKNVKNKQ