Identifiers and Description

Gene Model Identifier

Contig3441.0.g49

Standard Name

SMC2a

Aliases

Contig3441_0_g49

Description

RecF/RecN/SMC N terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008129509.997093137033517e-262SMC family, C-terminal domain
containing protein
SGDYFR031C4.997692805068281e-176SMC2 SGDID:S000001927, Chr VI
from 220106-216594, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3441.0.g49(coding)
ATGCACATACTCGAAATCATTATTGATGGATTCAAATCCTACTCTCACAGAACTGTAATT
GAAAAGTTTGATCCTTAGTTCAATGCAATCACCGGGCTAAACGGCAGTGGGAAATCGAAC
ATCCTGGATGCCATCTGCTTCGTATTGGGTATCTCACAGTTAGCACATGTCAGAGCTGAG
AAGCTGCAAGAATTAGTCTACAAACAAGGAAACTCTGGTGTAACTAAGGCTAGTGTCACC
ATCGTCTTTGATAATAGCAACAAAGATTAGAGTCCACCCGGCTATAGCGACATGCCAAAG
ATTAGTGTTTGCCGTACTGTTGAAAACTAAAAGTCTAAGTACTACATAAATGGATCAACA
GCAACAGCTGAAAAAGTGAAGTCGCTCTTCTGCTCTGTGAAACTCAACGTGAATAATCCT
CACTTCCTTATCATGCAAGGAAGAGTAACCAAGGTCATCAACATGAAGCCAATGGAAATC
TTGGGACTCATTGAGGAAGCAGCTGGCATCAGTCTTTATCAAACCAAGAAAGAGCAGACT
CTTGCACTTATCAAGAAAAAGGACAACAAATTACAAGAGATCAATAAGATCCTTGAGGAA
GAAGTCAACCCTTAGCTTGAAACACTACGTAAAGATAAGGAGGACTATGCAATGTTCAAG
ACAAATGAGAGTCAAATTGAGCAAAATGAGAAAGTAATTATTGCGCATTAATTCTGGGAG
AACGACTTGATCTTAAACAACAGTGACAACAGAAGTTCCACCTTGCAAAACAGGAAGCAT
CAAATTGAATCACAAATTGAAAACAAAACCAGAGAAATAGAGCAAATTAAGGCTTAAGTG
AGTCAAGCTTAGCAGAATCTTACTCACAACGAGGCTGAGAAGAAGTTAAAAGAGGAAATA
GCGCTATTGGAAAATGAAATCTACAAATTCACTCTAGAAAAGCAAAAACTACAAACAGAG
GAAGAGCAGTTTGCACAGAAGAAGCAAAAGGATTTACAGGAGACTGATTAATTGAGGCAA
TAAATAACTCGATACAAGAGGAAGATAGAAGATCTTAACAGTGAAAATATGGAGTAGACT
GAGAAAGAAATTGACTAGAACAAGGAGCAGTAGAGAGACCTCGAGAGAGAAATCAAACTT
ATCAAGGAGGGCAAGGAAAGTTCAGGGTCTGCAATGGGTGCTATTTAGAGGCAAATCTAG
GAAGTTAATAATAACTTGGAGATGACCAAGAACAAGGGCAGAGACTTCTAGAATCAAGTA
AGATTGAAACATAACGCAATTCAAGATGCAGAAAGGGATAATAAAAACAGAGAAGAAGAA
GCTAAGAATTTTGATAGAGTTCTAGAAGACTCAAAACGTCAGATAGATAACCTTCAAAGT
TAAATTGAAGAGAAGAAATCAGACCTTGATCACTATTAAAAATTAAAGGAAGATAAAGCT
TAAATTGAGCAAAAGATTCGAGAATTCGAAGCTGAAGTGTAAGGTATGCAAAGAAACTTG
GTATATGGAAAAATAATCAAGCTATTCAAAGTCAAGGATACTGTAAAGAATGGATTAGCA
TTAGAGCAAATTGCAGCTGCTAAGCTTGGAAATGTTGTAGTCAAGAATGAAAGAGTATCA
AAGGAATTGATTCAGAATAGATGCTCAAATAACATAGTTACCTACATTCCACTGAATTAG
ATTAATGGATTCGTCTTGCAGAACGATATTAAAAACAAGCTATTGGATCTAGGATAAGGA
AAGGTGTGGTATGCAAAAGATTTGATAGAGTACGATCCAGAATTTGAGCCAGCTATGAAC
TTTGTCTTTGGAGGAGCTTTTGTGGCAGCTGATAATGAGACTGCTAAAAAGGTATGTTAC
AATAACATCAAGCCTTCTCTGTGTGTGACACTACAAGGATCTAAATATAATCCTTAGGGT
ATCCTCGAAGGTGGTCATATGAAAAATGAGCCTATTATTCTACCATGCCATAAGTATCTC
TAAATTGCTGATAAGAAAGCTGAACTTTATCAAGCAAAAGATAAAGTGGAAAGACAGCTT
AATTAGCTTTCTAGTGTTTACAATTTGATTGAGGACATGAAGCAAAAGCTATAATTGGCA
CAGCATGACTACAATATAAAATCCTAAAGAGCCAAAGAATTTTAAGAGGGAGGTGTATTT
TCAGATAAAAATAGGCTTGCTGCACTCAAGGAAGAAGTGCAAGATCTCTAAGTTAAGTTT
AAGTAAACTTAAGACAAAGAGAAGCAGTTTTAGAAAGACCTTGAAGTTCTCAAAACTGAG
ATGAATCAAATGTAGCAAACTTAAGGTTAAACTGGTCAACAGAAAGAAAAATATTACATG
GACAAGATTAAGAAGATTCAAATTTAAAGAGAAGAATTACTAAAGTCACTTCAAGGCATG
AGAGATTAGAAAAACCAGCTTGAAATAAAGATAGATGAAGCTAACTAAGATATAGTTCAA
ATCGAGCAAAGTTTGAATGTAGAAGAGAAGCGTATTAAGGAAGAGAAAAATAACGCGAAG
CCTTAACTCGCAAAGTTAAATGAAGATGAGAAGAAACTCGACTAGCTGAAATTGAAGCTG
AAGCAAAAGGAAGATGAAAAGACAAGGACTAACAAAGAGATGGAAAATTTAGTCAAGACT
CAAACCACTAGATAGAATGCAGTTGGTACATTAACTGAAGATCTGAAGGAAGTTCAAGAT
TAGATAAAAAGATTTGAACAAGATATAAGGCATTCGAGAAAGAATGTCTAGGAGCTGCTA
TCTTTACATAAATGGATAGAAACTGAGAGAGAATTCTTTGGTGTAGCTGGTCACAGATAC
CACTTTGAGAAAATTAACATCAACAGATTAATCGATGAGACTAAGAGGATCTAAGATGAA
AACAATTCCTTGAAAAAGCGTATCAACTTGAAGGTAGATGCAATGTTTGAGAGAACAGAG
TAGTAATACAATGATTTGCAAAGAAAGAAGGAAACTACCCTTAGAAACAAGGAATAATTT
GACTCTACAATTAATGAGCTAGACGACTTAAAGAACAAAGAAGTTGAAAGAACTTATACA
GCTGTTAATAAGTATTGCTCAGAGATTTTTAGTACCTTACTTCAAGGTGCTATGGCAAAA
TTAGTGCCTTAAGAAGGAAAATCTGTCCTAGAAGGCTTGGAACTTAAAGTCGGTTTTAGT
AACTCCTGGAAGGATAGTCTAACTGAACTTAGTGGTGGTTAAAGATCGCTACTTGCTCTT
AGTCTTATTCTTGCTCTACTCAAGTATCATCCAGCTCCATTATACATCTTAGATGAAATA
GATTCTGCTCTGGATTTGTCACACACTCAAAACATCGGTATCATGATAAGAAAATTCTTC
CAGACTTCTTAGTTCGTCATTGTATCTTTGAAAGAAGGGCTCTTTTAAAATGCAAATGTG
CTCTTTAAAGTACAATTCGTAGAGAATCACTCTCAAGTCAAGAGATTTTAAGTTAGAAAG
AACATCACTCAACAACCTAACTCATCTAATGCTGAAAATTTAAACCAATCTAACATAATG
ATGTAATAAAACCCTAACAATAGAAAGAAAGCTAGAAATAATCAGAACGAGGAAGAAGAA
AAGTACCAAGAGCAAGATGATGTTGAGATGATACAAACATGA


>Contig3441.0.g49(protein)
MHILEIIIDGFKSYSHRTVIEKFDPQFNAITGLNGSGKSNILDAICFVLGISQLAHVRAE
KLQELVYKQGNSGVTKASVTIVFDNSNKDQSPPGYSDMPKISVCRTVENQKSKYYINGST
ATAEKVKSLFCSVKLNVNNPHFLIMQGRVTKVINMKPMEILGLIEEAAGISLYQTKKEQT
LALIKKKDNKLQEINKILEEEVNPQLETLRKDKEDYAMFKTNESQIEQNEKVIIAHQFWE
NDLILNNSDNRSSTLQNRKHQIESQIENKTREIEQIKAQVSQAQQNLTHNEAEKKLKEEI
ALLENEIYKFTLEKQKLQTEEEQFAQKKQKDLQETDQLRQQITRYKRKIEDLNSENMEQT
EKEIDQNKEQQRDLEREIKLIKEGKESSGSAMGAIQRQIQEVNNNLEMTKNKGRDFQNQV
RLKHNAIQDAERDNKNREEEAKNFDRVLEDSKRQIDNLQSQIEEKKSDLDHYQKLKEDKA
QIEQKIREFEAEVQGMQRNLVYGKIIKLFKVKDTVKNGLALEQIAAAKLGNVVVKNERVS
KELIQNRCSNNIVTYIPLNQINGFVLQNDIKNKLLDLGQGKVWYAKDLIEYDPEFEPAMN
FVFGGAFVAADNETAKKVCYNNIKPSLCVTLQGSKYNPQGILEGGHMKNEPIILPCHKYL
QIADKKAELYQAKDKVERQLNQLSSVYNLIEDMKQKLQLAQHDYNIKSQRAKEFQEGGVF
SDKNRLAALKEEVQDLQVKFKQTQDKEKQFQKDLEVLKTEMNQMQQTQGQTGQQKEKYYM
DKIKKIQIQREELLKSLQGMRDQKNQLEIKIDEANQDIVQIEQSLNVEEKRIKEEKNNAK
PQLAKLNEDEKKLDQLKLKLKQKEDEKTRTNKEMENLVKTQTTRQNAVGTLTEDLKEVQD
QIKRFEQDIRHSRKNVQELLSLHKWIETEREFFGVAGHRYHFEKININRLIDETKRIQDE
NNSLKKRINLKVDAMFERTEQQYNDLQRKKETTLRNKEQFDSTINELDDLKNKEVERTYT
AVNKYCSEIFSTLLQGAMAKLVPQEGKSVLEGLELKVGFSNSWKDSLTELSGGQRSLLAL
SLILALLKYHPAPLYILDEIDSALDLSHTQNIGIMIRKFFQTSQFVIVSLKEGLFQNANV
LFKVQFVENHSQVKRFQVRKNITQQPNSSNAENLNQSNIMMQQNPNNRKKARNNQNEEEE
KYQEQDDVEMIQT