Identifiers and Description

Gene Model Identifier

Contig18105.0.g52

Standard Name

SMC1

Aliases

Contig18105_0_g52

Description

RecF/RecN/SMC N terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYFL008W8.001993295941272e-61SMC1 SGDID:S000001886, Chr VI
from 119429-123106, Genom...
T. thermophilaTTHERM_010480902.9993743585281133e-40SMC family, C-terminal domain
containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18105.0.g52(coding)
ATGACTGACTTAAGTTTTTAAAAGAATCCATTCCTTGAACAAACAGACAAGCTTAACAAA
AGTATGAACAACTCAATGTTGAGGAGAGAAGGGCATTTCCAAGATCAACTACTTCACCTA
ACTTCAATTGAGTTGCTAAACTTCAAATCATTTGAGGGCACACATTTAATTGGACCTTTC
CTTTCCTTCACAGCTATCATTGGCCCTAATGGTTCAGGCAAGTCAAACGTGCTTGATGCC
CTTGCTTTCGCTCTTCTACTGAAACACATATCTACTAAGCATAAACACTTGAGTGAGCTG
ATCTACAGAGAAGAACATGAGAATCATAGAGACAACAGAAGAGAAATGAGCGTCATGATC
AACTTTAAAGCTACCAACATTCAAGACCAGTCTACAAAAGATTACTCCATTAAGCGTATG
ATAAACAGAAATGGAGTCTAAGAGTACTTTTTCAATGGAACACCATTGATTGGGGAAGAG
TATCTTGCCAAGATTAATGAGATGCACCTAAACATCAACAACTTTTGTGCATATCAGGGA
AAACTTGAACAAATCTGCTTCAAGCAAGAAGGTGGTCACCTGGTTTAAATGTTCGAAGAG
TTGTCTGGATCTTACTAATTCAAAGCCAAATATGATGAACTCAAGCAAAATATTGCAAAG
TGTGATGAGAAGATCAAGTAAGATTCTGAGATTCTGCATACTTTAAGAATTGAGAAAGTA
AAACTCAAAGGTCTTTAAGAGTTTGTTGAGCAAATGAAGGATTGCCTTGTGGAACAGAAG
GAAGTTGAAAGCCAACTATCAATTGCTCAAATACTTATATCTCACAAGAACATTCAAGCA
TTGAGATTAAAAATGCAAGAGTACGAACGAGGAATATAAGATACAATTCAGCAAAAGTAA
GCCTCAATTAATGATCTCAAAAAGTTTGAGGCAGATATGAGAAAACTCCAAAATCAAGAA
GAGTAAGTGACAAAGAAAATTAAGTCAAAAAAGGATGAGTTACTTGGATTGCAAAATAAT
GTTTTCAACAAGCAAAAGGAGGTCGATACTAGTAAATCTATGATTACTCAAAAGAAGCAA
ATGCTTCAGAAATTCTAATATGAGTTGGAAGATACAATTAAGAAGAGAGCTCTTCATTAA
GAAACTATTGAAAAAGCCAGACATGACCTTCAACTTCTTAATAAAGAAATCGTGATGAAT
GAGGATCTTTAACAATAAGATGCTTTGAGAGATGAGTACTTAACCATAAAGAGCAGATTA
GAATCTGAAAACGCACAAATTGGTAGACAAATGACAATGATTGAATAAAAGATCTAGTCA
CTAAATCAGAAAAAAGCCAATATTCAGGGTCATTTGTTCTAATAAAAGGAACAAAACAAG
AAAGTCTAAGACTTGGATATGATTAAACAGGAGCTCAAAGCTTTAGAGGCTGATCTCAAA
GAAAAAGATAAGAGTTATAGTAAAGCTCAGAATGAGCACAGATTGTTATTGGATGAAGCA
ACCAAGAACAAGGACAAAGTAAAGACTTTGGAGAAGCAGCTCTTAGAGAAAGAGTATGAA
CTAAAGGACATCGAAAATGAAAGAAACATCAAGTCTTAAGACTAGAAGCTAAGCTAAACT
CTGGAAGAACTAAAGAACAGATGTAAAGGATATCTAGGGCAACTTTATGAACTAATCAAG
CCTATTAACGCTAAGTACGATATTGCAGTCAAGGTTGCTTTAAGCAAATGTTTGAGATTC
CTTGTGGTAGATACTCCACAAACAGCAGAGTACTGCACAGAGTTCCTCAAAGAAAAAGGA
CTTTTCAAGGATGTACTTGTCTTGCAAAATGTGCCTGAGAAAAACATCAACTCTAAACTA
GCTAAAGAGTTAAAGACTGAGGGTAATTTAGTGTATGATGTGATAGAAGTGAGTCGCAAG
CATCATCACATTGAAAGAGCTGTAAGATACTTCTTAGGAGATAAAGTAGTTTGCAAAGAA
TTTGACACAGCTATAAAGCTACAGAGAATGGGAGTGAAGGATATTGTTACTGAAGATGGC
AAAGAATTCAAACCTGGTATGATAAGCGGTGGTCAACAAACTAACATTTTCAACCTGAAC
CTTGGAAATTTCAAAATGGACAGAGACATTAAAAAACTGGCTGAAGAGATTTAAACTCTC
GAGAACTAATTGAATTAACTCAAAGAATCAGAGTATGGTGAATCAAGCTTACAAAAGATT
ATAAGAGATGTCAGCAGACTTGAAACAGAAATTGAGATATTACAAGGCAAAATACAGAAC
AAGAAGAATTAGATTAAGAACTTCGAGGAAAACTAAAAAGAGACAGTGGCTATTTTGAAA
TAGTTCGAAACATAAATAGCTGATTTTGATAAGCAATTAAACTAAGCTCACTAAGCTAAA
CAGGCTCTTCAGAGCGATTTGCAAGAAGCCTCAGATGAAGCATTTTCTGGATTTTTGAAG
AAGATTGGAGTGAATTCAATAGAAGAGTATGAGCATTCTAGAGACAACGAGTAGGCAAGA
AATTTCAATGTTCAGAAAAATCAGTTGTTGCAAGTGATTTCATAGCATGAAGCCGAACTG
TAATTCATTGAAAAGAATGACTCTAGCAAGCATGATGGGATTTCTGCAATTGAAAACATT
CTTAAACAAGAAGAGGACAAATTGGCAGCACTTATGTCTGATTAGTATCAAGCAGAGGTT
GTTCAGAAACTGCAAACTGAAATCAAGGATATGAACGATGATCTCCTTAATATCAAGAAA
CAATCTAGCGAAATAACCTCACAGTAATTTAAGGTCAAATAGCAGAATGATCTTATTTAA
ACTAGATTTGATCACTTCTAAAAAGAGATTACAGTCCATAGAATCCAGATTAAAAATGAA
GAGTCAGAGAAGCAAGCAAGAATTGAAGAGGGTCAATTAAACATGATTATCAATGTGTAA
AACGATGCTGATGCAATGGCACAGATAGACTTCAATCACAAGCTTGGAATTGATAATATT
GATGAAATTGCTTAAGAGGAAGTCCAAGAAATCATCTAAATCAAGAAAGAGAAACTCCGC
AAACTCAGATCAAAGGAGGACGAATTCAATAAAAATGCTGCTTTAGTTCCTGAGAGTGAT
CCTAATGTTTCAATGATAAATGACAAGATTCAATAAGTCAAGGATGATGTTGACAAGCTC
AGTCAAGAAAGAACCCAGTATTCAAGTGAGTTGAAAAAGGTTCAGGAACAGAGGGTTAAT
ATCTTCATAAACTTCTTTGATAATGTATCATAAATCTTGCAGGACACCTACTAAAAGCTA
ACTATGAAAGATTCTAACTTGAATTAAGGTGGAAAAGTGACTATTTTCATTGAAGATAGA
CAGAACCCTTTTGACAAAAGCATTCATTACTTCCCATAACCTCCCAATAAATCTCATATT
TATGATATTTCTTAACTTTCAGGAGGAGAGAAAACTGTGGCAGCCTTAGCTTTGATTTTC
TCTTTGATACAGATTAGAAGACCCCCTATGTTACTGTTAGATGAAGTTGATGCCTTTTTG
GATGTTGAGAATGTTCAGCTTGTGACTGATTTCATCAAGAATGAACTTAAAACTCAAACT
TTGATCATCAGTCACAAAGAGTTTGTAATCAAGAATACTCTCTCACTAATTGGTGCTTCT
TTTGTCAAAGATCAGAAAACCAGTATGGCCTATAGTCTAGATTTAAGAAACTATAAAGAT
TGA


>Contig18105.0.g52(protein)
MTDLSFQKNPFLEQTDKLNKSMNNSMLRREGHFQDQLLHLTSIELLNFKSFEGTHLIGPF
LSFTAIIGPNGSGKSNVLDALAFALLLKHISTKHKHLSELIYREEHENHRDNRREMSVMI
NFKATNIQDQSTKDYSIKRMINRNGVQEYFFNGTPLIGEEYLAKINEMHLNINNFCAYQG
KLEQICFKQEGGHLVQMFEELSGSYQFKAKYDELKQNIAKCDEKIKQDSEILHTLRIEKV
KLKGLQEFVEQMKDCLVEQKEVESQLSIAQILISHKNIQALRLKMQEYERGIQDTIQQKQ
ASINDLKKFEADMRKLQNQEEQVTKKIKSKKDELLGLQNNVFNKQKEVDTSKSMITQKKQ
MLQKFQYELEDTIKKRALHQETIEKARHDLQLLNKEIVMNEDLQQQDALRDEYLTIKSRL
ESENAQIGRQMTMIEQKIQSLNQKKANIQGHLFQQKEQNKKVQDLDMIKQELKALEADLK
EKDKSYSKAQNEHRLLLDEATKNKDKVKTLEKQLLEKEYELKDIENERNIKSQDQKLSQT
LEELKNRCKGYLGQLYELIKPINAKYDIAVKVALSKCLRFLVVDTPQTAEYCTEFLKEKG
LFKDVLVLQNVPEKNINSKLAKELKTEGNLVYDVIEVSRKHHHIERAVRYFLGDKVVCKE
FDTAIKLQRMGVKDIVTEDGKEFKPGMISGGQQTNIFNLNLGNFKMDRDIKKLAEEIQTL
ENQLNQLKESEYGESSLQKIIRDVSRLETEIEILQGKIQNKKNQIKNFEENQKETVAILK
QFETQIADFDKQLNQAHQAKQALQSDLQEASDEAFSGFLKKIGVNSIEEYEHSRDNEQAR
NFNVQKNQLLQVISQHEAELQFIEKNDSSKHDGISAIENILKQEEDKLAALMSDQYQAEV
VQKLQTEIKDMNDDLLNIKKQSSEITSQQFKVKQQNDLIQTRFDHFQKEITVHRIQIKNE
ESEKQARIEEGQLNMIINVQNDADAMAQIDFNHKLGIDNIDEIAQEEVQEIIQIKKEKLR
KLRSKEDEFNKNAALVPESDPNVSMINDKIQQVKDDVDKLSQERTQYSSELKKVQEQRVN
IFINFFDNVSQILQDTYQKLTMKDSNLNQGGKVTIFIEDRQNPFDKSIHYFPQPPNKSHI
YDISQLSGGEKTVAALALIFSLIQIRRPPMLLLDEVDAFLDVENVQLVTDFIKNELKTQT
LIISHKEFVIKNTLSLIGASFVKDQKTSMAYSLDLRNYKD